KEGG   Hippocampus comes (tiger tail seahorse): 109513829
Entry
109513829         CDS       T04969                                 

Gene name
bcl2l1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04137  Mitophagy - animal
hcq04140  Autophagy - animal
hcq04210  Apoptosis
hcq04621  NOD-like receptor signaling pathway
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109513829 (bcl2l1)
   04137 Mitophagy - animal
    109513829 (bcl2l1)
  09143 Cell growth and death
   04210 Apoptosis
    109513829 (bcl2l1)
   04115 p53 signaling pathway
    109513829 (bcl2l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109513829 (bcl2l1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109513829 (bcl2l1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hcq01009]
    109513829 (bcl2l1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hcq03036]
    109513829 (bcl2l1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hcq02000]
    109513829 (bcl2l1)
Protein phosphatases and associated proteins [BR:hcq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109513829 (bcl2l1)
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109513829 (bcl2l1)
Transporters [BR:hcq02000]
 Other transporters
  Pores ion channels [TC:1]
   109513829 (bcl2l1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 109513829
NCBI-ProteinID: XP_019722087
UniProt: A0A3Q3DUT7
LinkDB
Position
Unknown
AA seq 225 aa
MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQTPANGTTNGT
SPPASPLREAASLDAVKEALRDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVVDEV
FQDDVNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWMTVYLDNHLQPWIESQGGWQR
FAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
NT seq 678 nt   +upstreamnt  +downstreamnt
atgtctcaaaatcgagaactggttttgttttacattaggtacaaactttcccagaaaaac
tacccgctcaaccacataggactcagacaggcattgaacaggactgatggcagggaggaa
gcctcaggcgaggaggagcagcgggtacagacgcctgccaatgggacgaccaacggcacc
agtcccccggcgtcgccgctacgagaggcggcgagcctggacgcggtgaaggaggccctg
cgggactcggccaatgagtttgagttgcgctactcccacgccttcagcgacctggacaaa
cagctgcacattacaccggccactgcctaccaaagctttgagaacgttgtggatgaggtg
ttccaggacgacgtcaactggggccgcatcgtggggctcttcgcgttcggcggcgcgctg
tgcgtcgaatgcatggagaaggagatgatccccctggttgacaggatcatcgagtggatg
acggtgtacctggacaaccaccttcagccctggatagagagccaaggaggatggcaacgc
tttgccgaaatttttggccacgacgcggcagcggaggtccgccgctcccaggagagtttc
aagaagtggcttttggccggggtgaccttggtgaccggggtcgtggtgggctcgctcatc
gcccagaagcgcctgtga

DBGET integrated database retrieval system