KEGG   Hippocampus comes (tiger tail seahorse): 109514406Help
Entry
109514406         CDS       T04969                                 

Definition
(RefSeq) lymphocyte-specific protein 1-like isoform X1
  KO
K14957  lymphocyte-specific protein 1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109514406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon
Motif
Other DBs
NCBI-GeneID: 109514406
NCBI-ProteinID: XP_019723052
LinkDB All DBs
Position
Unknown
AA seq 460 aa AA seqDB search
MSESIRRRSSSRQLLENLIQVTVQRSLEDAEEVERERRRRTRERQREEQTTLSVPHQQNR
STSSGVSDEELHPRGCFVQEEDEGFSDWSHRLHRLENRNDLEHVRAKAQEPSSMQWKAGR
NNKKQQDDEEQAEWQPTQRSHALQCTRSPPLGKKEVKLFLSNDPRQQQASDPQADTMLDL
ATERISKGVCLAKQEEERVQQTLQKEWRSCSGNRATYEVDHEAEDLDVTREEIKKRLSEF
EGNQKLTEERSKEEGCRSDDDKIRRAGLSLYSSDEDETLNCYGAMSPTFKKLLIQFYPDE
VKSRIPADGKCVITERTESLRKSSNSQKIPQPLCVSKIDKKLQQYTHALEVSTKESKPAS
PVLVDAMSPIAHKKNLFEAGVAWNQNTLANTPPKEIKPGVVLSKKNVWEGYSDIVSLASS
GRDTKECSAGKMYKFVAMAHGKYEKVSDEDGLRDDANWAA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagtccatcagaagaagaagctccagcagacagctcctggaaaacctcatacag
gtgacggtacagcggagccttgaggatgcagaggaggtggagcgagaacgcaggaggaga
accagggagaggcagcgagaagaacagaccactctgtcggtgcctcaccagcaaaatagg
tcaacatcttcaggagtgtcagacgaagagctgcatcctcgtggttgctttgtgcaggag
gaggatgaggggttcagtgactggagccacaggttgcacagattggaaaatcgtaatgat
cttgagcacgtcagggccaaggcacaagaaccttcatcaatgcagtggaaggcaggcaga
aataacaagaaacaacaggatgatgaagagcaggcggaatggcagccgacacaaaggagc
catgccctgcaatgtacaagaagccctccactggggaaaaaagaagtcaagctgtttctg
tcaaatgatccaagacaacagcaggccagcgacccgcaagcagacacaatgctggactta
gcgacagaaaggatcagcaaaggggtgtgcctggcgaagcaagaggaagaaagggtgcag
cagactttgcagaaggagtggagatcatgctcgggaaacagagcaacatatgaagttgat
catgaggcagaggatctcgacgtcacacgtgaagagatcaagaaaaggctctcagagttt
gagggaaaccagaagctgacagaagagaggtcaaaggaagaaggatgcaggagtgatgat
gataaaatccgtcgggctggcctttctctatacagcagtgatgaagatgagacattaaac
tgctatggagccatgagcccaacattcaagaaactcctcattcagttttacccagatgag
gtgaagagcagaataccagcagatggtaaatgtgtgatcacagagcgaacggaatctctg
agaaagagctccaacagccagaagattccacaacccctttgtgtttccaagatcgacaag
aaactacagcagtatacgcatgctcttgaggtttccacaaaggaaagcaaaccagcgagt
ccagtcttggtggatgcaatgagtcccatcgctcacaaaaagaatctttttgaggctgga
gtggcatggaaccaaaacacactcgcaaacacaccaccaaaggaaataaaacctggtgta
gttttaagcaagaaaaatgtgtgggagggctacagtgatatagtttctctcgcttcttcg
gggagggataccaaggaatgctcagccggtaaaatgtataaatttgtcgcgatggctcac
ggcaagtatgagaaggtttctgatgaggacggccttagagatgatgcaaactgggcagcc
tga

DBGET integrated database retrieval system