KEGG   Hippocampus comes (tiger tail seahorse): 109514452Help
Entry
109514452         CDS       T04969                                 

Gene name
sord
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00040  Pentose and glucuronate interconversions
hcq00051  Fructose and mannose metabolism
hcq01100  Metabolic pathways
Module
hcq_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    109514452 (sord)
   00051 Fructose and mannose metabolism
    109514452 (sord)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     109514452 (sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 109514452
NCBI-ProteinID: XP_019723139
UniProt: A0A3Q2Y1T4
LinkDB All DBs
Position
Unknown
AA seq 354 aa AA seqDB search
MEQDNLSVVLHSKGDLRLEKRPVPEPGPNEVLLQMHSVGICGSDVHYWQHGSIGDFVLTK
PMVLGHEAAGRVVKVGSAVKHLQAGDRVAVEPTVPREMDEFFKSGRYNLSPTIFCCATPP
DDGSLCRYYTHSANFCYKLPDNVTFEEGSLVEPLSVGIHACRRAGVTLGSTVLICGAGPI
GLVSLLVAKAMGASQVVITDLFPERLAMAKVLGADFQLTVKQGDGPQQLAKRVEGLLGAQ
PHITIECTGVESSIQTAIYATRSGGVVVVVGLGSEMATIPLINAATREVDIRGVFRYCNT
WPMAIAMLASGKVNVKPLVTHRFPLEQAVQAFETTRQGLGIKVMLKCDQNDQNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagacaatctgtccgtggttctgcactccaagggagacctcagactggagaaa
cgccctgtcccggagccaggtcctaatgaggttttgctccagatgcactcagttggtatc
tgcggttctgatgtccactactggcaacacggcagcattggggactttgtgctgacgaag
ccaatggtgttaggacatgaagcagcgggacgggtggtaaaggtcggctctgcagtcaaa
caccttcaagcaggagacagagtggctgttgagccaactgttccccgagagatggacgag
tttttcaaaagcgggcgctacaatttatcgccgactatcttctgttgtgccacgccgccc
gatgatggcagcttgtgcagatactacacacacagtgccaacttctgttacaagttgcct
gataatgtgacatttgaggaggggtctctggttgaacctctgtccgtgggcatccacgcc
tgtcgcagggccggcgtgaccctcgggagcaccgtgctcatctgtggtgcagggccaatt
gggttggtctctctgcttgtggccaaggcaatgggcgcttcacaagttgtcatcacggat
ctgttccctgagcgtttggccatggccaaggttttgggtgcagacttccagctgactgtg
aagcaaggggacggacctcagcagttggccaagagggtggagggtctactgggagctcag
cctcacattacgattgaatgcactggcgttgagagcagcatccaaactgccatctacgcg
acccgctcaggaggtgttgtggttgtggtgggccttggatcagaaatggccaccattcct
ctcatcaacgcggccaccagagaagtggacatcagaggcgtcttccgctactgcaacact
tggcccatggccatcgccatgttggcatcaggaaaagtgaatgtgaaacctctggtgact
caccgtttccccctggagcaggccgtccaggcgtttgagaccacacgtcagggtcttggg
ataaaggtcatgttaaagtgtgaccagaatgaccagaatccctaa

DBGET integrated database retrieval system