KEGG   Hippocampus comes (tiger tail seahorse): 109515099
Entry
109515099         CDS       T04969                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109515099 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hcq04052]
    109515099 (epo)
Cytokines and growth factors [BR:hcq04052]
 Cytokines
  CSF and other factors
   109515099 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 109515099
NCBI-ProteinID: XP_019724245
LinkDB
Position
Unknown
AA seq 185 aa
MLQNTGRGLLALLLMVLEWTCPSLPSPLRPICDLRVLNHFIKEAQDAEVAMKSCRNGCSL
SQSVSIPQTRVDFDVWDRKNAMEKAQEVQCGLWLLQQALGLLRSSVTNAALHGHIDNLVR
NVLSINAVLRSLNIPEYTPPASSAGLESTWRASTAADLLQVHVNFLRGKVRLLLTDAQAC
QQDVS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttgcagaacaccggtagaggactacttgccttgctgttgatggtgttggagtggacc
tgcccaagcctgccatccccgctgaggcccatctgcgacctgagggtgctgaaccatttc
atcaaagaagcgcaagacgccgaagtcgccatgaagtcatgccggaatggatgcagcctg
tctcagtccgtcagcattccccaaaccagagtagactttgacgtctgggataggaaaaat
gccatggagaaagcccaggaagtgcagtgcggactgtggctcctgcagcaggccctcggc
ttgctgcgcagctcggtcaccaacgcggcgctgcacggccacatcgacaacttggtgagg
aacgtgctcagcatcaacgccgtgctgcgcagcctcaacattccggaatacacgcctccg
gcgagctcggcgggcctggagagcacatggcgggcgtccacggcggccgacttgctccaa
gtgcacgtcaacttcctgcgaggcaaagtgcgcctccttctcacggacgcgcaggcctgt
cagcaagacgtcagctga

DBGET integrated database retrieval system