KEGG   Hippocampus comes (tiger tail seahorse): 109515145
Entry
109515145         CDS       T04969                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04141  Protein processing in endoplasmic reticulum
hcq04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109515145 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109515145 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hcq03000]
    109515145 (atf6b)
Transcription factors [BR:hcq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109515145 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA CENP-H DUF4407 MCU
Other DBs
NCBI-GeneID: 109515145
NCBI-ProteinID: XP_019724300
LinkDB
Position
Unknown
AA seq 638 aa
MSLDMLCDSDVGRFFADNLLTNEDWDACLYHCDGVEDDDKQLGLASEYDTLLEDELAQPL
DGEASSCPWRCMPDDRAAGGVSAQRNVQSVAAEPMELLLQVKAEPASPVWSSEAERSSAA
GAAPPEPAVPVKGENPPTPPYAFGDVMSPPPDPAELAAATTAILTPGVAPRLPALVTSIQ
TQATVIPALKTSTLAAKPPLQPRPLCLAAVPVARTPAPAKALLLRGLPAMEPARPVVCLT
SAPAVVKMEHAVSPAATKPIVPNGATLPGNGPNDVDMKVLKRQQRMIKNRESACQSRKKK
KEYVHNLELQLKEAQQENQRLRRENQELRQRLEAGRQGGESPGGKRAVCVMAVFLFVTFS
LGPVSILDRKLTAGFGDGARSLEVPAGAAPDEGGELETFAAESLPFRNASSAFGAAKEES
NLLRRLEGYFSHAHCPQFNRSESLRLAAELRGWAQRHQINHKKSGGKAKKAKMAQRAQLR
KANVSRYLPIQTHRSIESQLQLLPGPELTYGDFLDSIDRREDTFYVVSFRRDHLLLPAIS
HNKTRRPKMSLVMPAMSVSESLYNASHGYELMMQVDCEVMNTRTVPIKSSSVPPSRRDPP
PTSPPHAAASNHSALRGRHQHQPPRPRAEYLLSQSEGV
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgagtctggacatgctgtgcgactcggacgtcgggcgattctttgccgacaatctgctc
accaacgaagattgggacgcgtgtttgtatcactgcgacggcgtggaggatgacgacaaa
caactgggcctggcctccgagtatgacactttgttggaggacgagctggcccagccgctg
gatggcgaagcctcctcgtgtccatggcgatgcatgcccgacgaccgggcggcaggtggc
gtcagcgcgcaaaggaacgtccaaagcgtcgcggctgagccgatggagcttttgttgcag
gtgaaagccgagccggcgtctcccgtgtggtcgtccgaggccgagcggtcgtcggcggca
ggggcggctcctcctgaacctgcggtccccgtgaaaggcgagaaccccccgacgcctccc
tacgcatttggagacgtgatgtcccccccgccggatcccgccgagctcgccgcggccacg
acggccatattgacgccgggcgtggcgccgcggcttcccgccctggtgacgtccatccaa
acgcaggcgacagtgattccggcgctgaagacgagtaccctggccgccaaaccgcccctc
cagccgcgccccttgtgcctggccgccgtgcccgtggcccggacgccggcgcccgccaag
gccctgctcctgcgtggccttcccgccatggagccggcgcgacccgtggtgtgcctgacg
tcggcccccgccgtggtcaagatggagcacgccgtctcgcccgccgccaccaaacccatc
gtcccgaacggcgccacgttgcccggcaacggccccaacgacgtcgacatgaaagttctg
aagcggcagcagaggatgatcaagaaccgcgagtccgcctgtcagtcgcgcaagaagaag
aaggagtacgtgcacaacttggagctccagctgaaggaggctcagcaggagaaccagcga
ctccgtcgcgagaaccaggagctccgccaaaggctggaggctggccggcagggcggcgag
tctcccgggggtaaacgagccgtgtgcgtcatggccgtctttctctttgtgaccttcagc
ttgggaccggtcagcatcttggacaggaagttgacggcgggcttcggcgacggcgccaga
tccttggaagtccccgccggcgccgcgccggacgaaggcggagagctggaaacgtttgcg
gcggaatctttacctttcagaaacgccagttcggcctttggcgcggccaaggaggagagc
aacctgctgcgccgcctggaaggatactttagccacgcccactgcccgcagttcaaccgc
tcggagtcgctcaggctggcggcagagcttcgtggctgggctcagcgccatcagatcaac
cacaagaagtcaggcgggaaagccaagaaggccaagatggctcagcgggcccagctgagg
aaggccaacgtgtcgcgatacctgcccatccagactcaccgctccattgaaagtcagctg
cagctgcttcccgggcccgagttgacctacggcgacttcctggactcgatcgaccggcgc
gaggacaccttctacgtggtgtctttcagacgggaccacctcctgctgcccgctatcagt
cacaacaagacgcgccggcccaagatgtcgctcgtcatgcctgccatgtcggtcagcgag
agcctgtacaacgcgtcacatggctacgaactcatgatgcaggtggactgcgaggtgatg
aacacgcgcaccgtccccatcaagtcgtcgtccgtgcccccgtcgcggcgggacccgccg
ccgacgtccccgccgcacgctgccgcctccaaccactcggccctgcgagggcgccaccag
catcaaccgccgcgtccccgagccgaatacctcctcagtcagtccgagggcgtctga

DBGET integrated database retrieval system