KEGG   Hippocampus comes (tiger tail seahorse): 109515501Help
Entry
109515501         CDS       T04969                                 

Gene name
tgm1
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109515501 (tgm1)
Enzymes [BR:hcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109515501 (tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 109515501
NCBI-ProteinID: XP_019724895
LinkDB All DBs
Position
Unknown
AA seq 782 aa AA seqDB search
MPGERLTVRRISDVGRFPGAAPPTRVELSIHKEGEKTTEDTACRRWFRKMCPCCCKCQKS
NTYDVTDKVELVNPPTPIPELDGPKPENGDSKEMEVVKLSVRSVDLLSSKTGTNRQEHHT
DLYHTEELIIRRGQTFQIELELNRPFSADTDKLHLDLRTGPLPQVSKGTHVIIPLVDTLD
NKRWGAKIEEQKNNKVKLSVKSTANAAIGLYGLTVTTSPLKNETPNIYTSSKNIIMLFNP
WCAEDTVFLDDEEERKEYVLNDTGRIYYGTENQIGARTWNFGQFQEGILEACLFVLEKSD
MPPSGRGDPVNVVRVISAMINALDDYGVLIGKWSGNYSDGVSPAAWSGSVEILRKYHSSN
GMPVSYGQCWVFSGVTTSVLRCLGIPARSVTNFQSAHDTDVSLTTDVYFDEDMEPIDYLN
SDTVWNFHVWNDCWMARPDLPHGHGGWQAVDSTPQETSQGTFRCGPASVTAIRSGQVYLK
HDTPFVFAEVNSDKIYWQRNPDGTFSQIHSEKKAVGHSISTKAVGSDQRADITHLYKHQE
GSEEERIAVETACRFGSKPDVYSSPMAEDVRVEVRMEGEGPRMGADARLSIVVKNLSSEP
RRTTLHCQVAVMYYTGVVKGTIKKEQLPVELLPNEEQTIEWVLPYQQYQNQLVDQAALML
TLSGRVNETKQVLANQTCFRLLTPDLNITPLGEAVVGKEMAAKITFTNPLPRMLNGVLFR
VEGLGLQKGHEVFVGDVSGHSTVTLTEHFVPTQPGPRKLVASLDCKQLTQVHGVADIVVL
EQ
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtgagaggttgacagtcagacgcatatctgatgtggggcgctttcctggtgca
gccccgcccaccagggtggagttgtccattcacaaggaaggggaaaaaacaacagaggac
acggcttgccgccgctggtttaggaaaatgtgtccatgctgctgtaaatgccagaagagc
aatacctatgatgtcacggataaagtggaactggtaaaccctcccacacctattccagaa
cttgatgggccaaagccagaaaatggagattcaaaggaaatggaagtcgtgaagttgtcc
gtgcgctctgtggatctgctgagctccaagacgggaacgaacagacaggagcaccacact
gacctgtaccacacagaagagctgatcatccgcagaggacagacgttccaaatcgagcta
gagctcaacaggcccttcagcgctgacaccgacaagctgcatctagatctcagaacaggt
ccactaccacaggtgtccaaagggacccatgtcatcatcccactggtggataccttggac
aacaaacgatggggggcgaagattgaagagcagaaaaacaacaaggttaagttgtctgtc
aagtctacagccaatgctgcgattggtctttatggtctgacggtcacaacgagccccctg
aaaaatgaaactccaaatatttacacctccagcaagaacatcatcatgctcttcaaccct
tggtgtgcagaggacacagtattcctggatgatgaagaggagaggaaggagtatgtgttg
aatgacactggaagaatttattatggaactgagaatcaaattggagcccgcacgtggaat
tttggtcaatttcaagagggaatcttggaagcctgtctattcgttctggagaagagtgac
atgcctccatctggccggggggatcctgtaaatgttgtcagggtcatatcagccatgata
aacgccctagacgattatggagttctaatcggaaaatggtccgggaattactctgatggg
gtgtctccggctgcatggagcggcagtgtggagattctgagaaaataccactcctccaat
ggaatgcctgtgtcatatgggcaatgttgggtcttctccggagtcacgacatcagttctc
cgttgtctcggcatacctgctcgcagcgtgaccaacttccagtccgctcatgacactgat
gtgtccctcacgacggatgtttattttgatgaggatatggagccaatcgactacctcaat
agcgataccgtctggaatttccacgtatggaatgattgctggatggccaggccagacttg
ccccacggtcacgggggctggcaagctgtcgactccaccccccaggagacgagccagggt
accttccgctgtggccctgcctcggtcaccgccatccgctctggccaagtctacctcaaa
catgacacaccgtttgtttttgcagaggtcaacagtgacaagatctactggcaaaggaat
cccgatggtacattcagccagatccacagtgagaagaaggccgttggccactctatcagc
acgaaagcagtgggctctgaccagcgcgctgacatcactcatttgtacaaacatcaagaa
ggttcagaggaggaacgtatcgccgtagagactgcttgtcgttttggcagtaagccagat
gtctactcctcgcccatggcagaggacgtccgcgtagaagtgaggatggagggagagggg
cccagaatgggggccgacgcccggctgagcatcgtggtgaagaacctgagctctgagccc
cgtagaactacgctgcactgtcaggtggctgtcatgtactacaccggtgtggtgaagggc
accatcaagaaggagcagttgccagtggagcttttgcccaatgaagaacaaaccatcgag
tgggttttgccttatcaacaataccagaaccagctggtggatcaggcagcactgatgctg
acattgtccggaagagtcaacgagaccaagcaagtgttagccaaccagacgtgcttcagg
ctcctgacacctgatctcaacatcacgcctttgggagaagctgtggtcggtaaggaaatg
gcagccaagatcacgttcacgaacccgctgccaaggatgctgaatggcgtgctctttaga
gtggaaggactcggattgcagaaaggccacgaagtgtttgtgggtgacgtgagcggtcac
tccaccgtgacgctgacagaacacttcgtcccgacccaacccgggcccaggaaactggtg
gcatctctcgactgcaaacagctcacgcaagtgcacggagtggccgacatcgttgttctg
gaacaatga

DBGET integrated database retrieval system