KEGG   Hippocampus comes (tiger tail seahorse): 109515508Help
Entry
109515508         CDS       T04969                                 

Gene name
lct
Definition
(RefSeq) lactase-phlorizin hydrolase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00052  Galactose metabolism
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109515508 (lct)
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     109515508 (lct)
    3.2.1.108  lactase
     109515508 (lct)
Chaperones and folding catalysts [BR:hcq03110]
 Intramolecular chaperones
  Others
   109515508 (lct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 109515508
NCBI-ProteinID: XP_019724912
LinkDB All DBs
Position
Unknown
AA seq 1891 aa AA seqDB search
MKCLFLESLCLLCLYGSLSSELNGEEGLMLLAGPLQSQKNVFHCGGPIPPGSGRYFDSLR
GRGLTHFQVPLSWHRLLPSGQPGQPQRAVVSCYRTLLNQILSAGLQPLVILHASTVPEDL
KSQFGGWESPELRGMFALYAEFAFQEFGELAHSWVILSHLGEVWRDGPPPPDETYRQDLI
QLIRNIYQLYHRSFGDQGKVSVGWSASDNGLLSPIQTSLTMDFLSLRFESNCASTFNLTE
ELTKLKMTSQDVPILIYKMTLCDCADSRLQVLGNVLQVLRGNSMKIEGCDMMDVLGTMEK
EDLPTSTGVLGNSSGKTNSYQTVWDKFGVQLESERDLFLNGSFPSDFQWATSSESFKVEG
GWAEGGKGETIWDRFGHENKVFDNQTADQACDSYHKVDYDVYLLRGLHVNTYQFSISWAR
VLPSGYRRSRSHKGVLYYQKLIDALIESGIRPVVTLFHWDLPQELQNQGGWTNSSIIEAF
KDYADFCYSAFGDRVKTWNTFSSPWVVSYAGYAIGKHPPEVQDYGMGSYQVTHNIIKSHA
EAWHVYNDKYRSKQGGEVGIALNSDWAEPSDPSGYRDVEAAYRSLEFTLGWFAHPIFVDG
DYPAALKSQIDKKSKECPHSKPAFLPGFTLEESRRINGTADFFGLTHSTMRLINSSDGGC
AASLQGVGDFQSRVHPSWSPTTSDWIYSTPWGLRRLLNYIAAEYLKMKKVPVYVTGNGMP
TEYGGDPLNDTSRVDYLRRYINEALKARLLDGVDVRRFTVQSLMDGFEGRQGYSQRFGLH
YVNFEDPDRPRTPKQSAYFYSQVIKQNGFALSLPDGLDVRPTQFKPPSKALPPSEVPSKS
KVTWERFSHQSKFHRQTYHYGTFPRNFTWGVSSSAYQIEGAWNADGKGTSIWDVFAHKPG
SVPGNANGDVACDSYHRLQEDLYMLRALEVKSYRFSLSWSRIFPTGLRSSLNQKGVDFYN
RVIDELLVNGITPMVTLYHWDLPQELQNFGGWENSSMTDIFADFSDFCFSTFGDRVKFWL
TFNQPHTIAWSGYGLGRIPPNVRQPGSAPYRVAHNLIKAHAKAYRIYDEKYRKSQDGLVS
LALGSDWVEPKDVNVLREVVAADRAMQFQLGWFAHPIFKNGDYPDAMKWQVGNKSELQGL
AESRLPEFTEEERKSIRGTADVFCFNHFTTKTVSHATARLAPPSYEYDRDLAEEEVGESP
STAIQNQRAVAWGLRRLLNWVQAEYGDPEIYITDNGVATDSKTKWDDAARVFYFKTYIDE
ALKAYDLDGVKLRGYTAASLMDSFEWLDGFKVGFGLHHVDFQDLNRPRTPKYSAHFYHRV
IKDNGFPTPEDEKILYGNFAKNFIWSTATASYQIEGGWRADGKGLSIWDRFAHTPLRVFN
DDNGDVACDSYNKIDEDVSMLRQLKVTHYRFSISWPRVLPDGTTDYINEAGLSYYSRLVD
ALLDANIQPHVTLYHWDLPQALQDIGGWENETIVLKFRDYANLIFRRLGHKVKFWITINE
PYNIANVGHGYGAAAPGISFRPGTLPYIVGHHLLKAHAEAWHLYDDEYRSKQGGIISITI
NSDWSEPRNPYKQEDVDAARRVVQFYIGWFAHPIFKGDYSDMMKTIIRKRSLEAGLPKSR
LPEFTAKEVERIKGTYDYFGFNHYTTVLAFPVDFGNLQHYDADRGAGTIADRTWLDSGSS
WLKVSPFGFRRILNFIKEEYGNPPIIITENGISERGPVDLNDLHRSHYYEKYINQLLKAY
VLDGVDIRGYTAWSLMDNLEWATGFSERFGLFYVNHSDPKLPRVAKTSVATYATVIACNG
FPDPATGPHECLNHEVEGTTSAPGTPLPPVAPVNFLGITLSARDAEIGLNTLLALLAVAA
MLGVVCSSFYFLKTRRRFEESRPIRLTPNNE
NT seq 5676 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcttgttcctggagtctctgtgcctcctgtgtttgtatggtagcctgagcagt
gagctgaatggggaggagggcttgatgcttctcgcgggtccacttcagtcccagaagaat
gtctttcactgcggtggtcccatccctcctggatccggacggtactttgactctctccgg
ggaagaggtctcacccatttccaagtgcccctgtcctggcaccgactcctaccatcaggc
caacccgggcagccccaacgagccgtggtcagctgctaccggaccctgctgaaccagatc
ttgagtgcgggtctccagcctcttgtcatccttcacgcatccacagtgccagaagatctt
aagtcacagtttggaggatgggaaagcccagagctgcgggggatgtttgccctctacgca
gagtttgcctttcaagagtttggggagttggcccactcctgggtgatactcagccatctg
ggtgaggtttggcgcgatggaccaccaccacccgatgagacttatcggcaagatctcatt
caattgatccggaatatttaccaactttaccatcgtagctttggagaccaagggaaagtt
tctgttgggtggagcgcaagtgataacgggcttctttcaccgatccaaacttcactcacg
atggacttcctgtcactgcgtttcgagtccaactgtgcttccacgtttaatttgactgag
gagctgaccaagttgaagatgaccagtcaagatgtgcccatcctcatatacaagatgaca
ctctgtgattgtgctgacagtcgcttgcaggtgctcggaaatgtcttacaagtgctccgt
ggcaacagtatgaaaatagaaggatgtgacatgatggacgtgttaggcacgatggagaag
gaggatctgcctaccagcaccggcgttcttggcaattccagcggaaagacaaacagttac
cagactgtctgggataaatttggggtccagcttgaatccgaacgtgaccttttcctcaac
ggatccttcccctcggatttccagtgggccacctccagtgagtccttcaaagtggaagga
ggctgggccgaaggtgggaagggagaaaccatttgggatcgcttcggccacgaaaataaa
gtgtttgataatcagacggccgatcaagcttgcgacagttatcacaaggtggattacgac
gtctacctcctgcgaggcctccacgtcaacacctaccagttttccatctcgtgggcccgt
gttttgccctcaggctaccggaggagccggtctcataaaggagtgctctactatcaaaaa
ctaatcgacgctctcattgagtcgggaatacgaccggtcgtcaccctgtttcactgggac
ctgccccaggagctccagaatcagggcggatggacaaactcttccattattgaagccttc
aaggactacgccgacttctgctattccgctttcggagacagggtcaagacctggaacacg
ttcagtagtccttgggtggtgagctacgctggctatgccataggcaagcacccccccgaa
gtccaggattatgggatgggctcctaccaggtgactcacaacataatcaagtcccacgct
gaggcctggcacgtttacaatgacaaatacagaagcaaacaaggcggcgaggtgggaatc
gcgctcaactctgactgggccgagccctcggacccctccggatatcgagacgtggaggcg
gcctaccgttccctggaattcacgttaggatggtttgcgcaccccatatttgtggacggg
gactacccagcagctctgaagagtcagattgacaaaaagagcaaagagtgtcctcattcc
aaacctgcctttctgccaggtttcactcttgaagaaagtcgacggatcaatggaacagct
gacttttttggactcacccattctacaatgcggctgataaacagcagtgacggaggttgc
gccgcgagtctgcaaggcgtgggtgacttccagtcccgtgtccacccatcttggtctccg
acaacttcggactggatctattctacaccctggggactgagaaggcttcttaactatatc
gctgcggagtacctaaagatgaaaaaagtacctgtgtacgtaacaggcaatggcatgcca
acagagtatggaggggaccccctaaatgacaccagtagggtagactacttaaggaggtac
atcaatgaagctcttaaagcaagactccttgatggggtggatgtgcgcaggttcaccgtg
cagtcactaatggacggatttgaggggagacaaggctacagccaaaggtttgggctgcac
tacgtcaactttgaggacccagacaggccgaggaccccgaaacagtcggcatacttctac
tcacaggttatcaaacaaaatggatttgctctcagtcttccagatggtttggacgtgagg
ccgacacagttcaagcctccctcgaaagcattacctccttcagaggttccgtctaagtcc
aaggttacgtgggagagattctcccatcagtccaaattccaccgccagacctaccattat
ggcacttttccccgaaatttcacctggggagtatcatcttccgcttaccagattgaaggt
gcctggaatgcggatgggaaaggaacaagtatttgggacgtgtttgcccacaaaccagga
agtgtaccaggtaacgccaacggagacgtggcctgtgatagttaccacagactccaggag
gatctctacatgctgcgagctctagaggtgaagtcgtatcgattctccttgtcctggtcc
aggatcttcccgactggtctgcgaagttccctgaatcaaaagggtgttgacttttacaac
agggtcattgatgaacttctggtcaacggcatcacaccgatggtgacgttgtaccactgg
gatctccctcaggagttgcaaaactttggcggctgggagaattcaagcatgaccgacatt
tttgcagatttttccgatttctgcttctccacctttggagacagggtgaagttttggttg
actttcaaccagccacacaccatcgcatggtcagggtacggactcggacggattccccca
aatgttaggcagccaggaagtgcaccgtatagagtggcgcacaacctcataaaagcccat
gccaaagcttatcgtatctacgatgaaaaatatcgcaaatcccaggatggtctagtttcg
ctcgccctcggttctgactgggtagaaccaaaggacgtcaacgttcttcgcgaagtggtg
gctgccgaccgtgctatgcagtttcagttgggttggttcgcccaccccatttttaagaac
ggcgactatcccgacgcgatgaagtggcaggtcggaaacaagagcgaactccaaggtctg
gcggagtccagactaccagaattcacagaagaggaaaggaagtccatcaggggaaccgcc
gacgtgttctgcttcaaccacttcaccacaaagacagtaagccacgccacggctcggctc
gcgccgccgtcctacgaatatgatcgggatctggcagaagaagaggttggcgaatcacca
agcacggccatccaaaaccagagggctgtggcttggggcttaaggagactcctcaactgg
gtccaagccgaatacggcgatccagagatttacatcactgacaatggggttgctacggac
tcaaagacaaagtgggatgacgcggcaagagtgttttacttcaaaacctacattgacgag
gctctcaaagcgtacgatctggacggcgtgaagctgagaggctacacggccgcctctctc
atggactcattcgagtggctggacggcttcaaagtgggatttgggctgcaccacgtcgac
ttccaagatctgaaccgcccgagaacacccaagtactctgctcatttctaccatcgagtg
atcaaggacaacggatttcccacgccagaggatgaaaaaatactttatggaaattttgcc
aaaaacttcatctggagtactgcaacagcatcatatcagatcgaaggaggatggagggcc
gatggaaaaggtctgagcatttgggacaggttcgcccacacgcctctccgagtgttcaat
gacgataacggcgacgtcgcctgcgacagttacaacaaaatagacgaggatgtttccatg
ttgaggcaactcaaggtgacgcattaccgcttctccatatcctggccgagggttcttccc
gatggcaccaccgactacatcaacgaagctggactgagttactacagtcgcttggtggac
gccctgcttgatgccaacatccaacctcatgtcactctgtaccactgggaccttcctcaa
gctctgcaggacattggcggctgggagaatgaaaccattgtgctcaaattccgggattat
gccaacctcattttcagacgcctcggtcacaaagtcaaattctggattaccattaatgaa
ccgtacaacatcgccaatgtgggtcacgggtacggagccgctgcaccagggattagtttc
cggccgggcacattgccgtacatcgtgggccaccacttgctcaaagctcacgccgaggcc
tggcacctgtacgacgacgagtaccgcagcaaacagggcgggatcatctccatcaccatc
aattccgattggtcggagcccagaaacccgtacaagcaggaggacgtcgacgccgccagg
cgtgtggtgcagttctacattggctggtttgcgcaccccatctttaagggagactacagc
gatatgatgaagaccatcattcgaaagagaagcctggaagcgggcctgcccaaatctcgg
ttgccggaattcaccgccaaagaggtagaaagaatcaagggcacttacgattactttgga
ttcaaccattacacgaccgtgctggccttccccgtggacttcgggaaccttcagcattac
gatgccgatcgaggcgcagggacaattgcggatcgcacctggctggattcgggctcatcc
tggctcaaggtctcgccgttcggattccggaggatattgaacttcattaaggaggaatat
ggaaatcctccgattatcatcactgagaacggtatctcggagcgagggcccgtggatttg
aatgatctccacaggagccactactacgaaaagtacatcaaccagcttttgaaagcttat
gtgctggacggcgtggatattcggggctacacggcttggtcgttgatggacaacctggag
tgggccacgggattttcagaaaggttcggcctcttctacgtcaatcactcggaccccaaa
cttcctcgggtggccaagacctccgtggccacctacgccaccgtcatcgcctgtaacgga
ttcccagacccggccactgggccccacgagtgtctcaaccacgaggtggaagggacgaca
agtgcgcccggcacgcctcttccacccgtcgcccccgtcaacttcttgggaatcacgctc
tctgctcgagatgccgagatcggcctcaacacgctgcttgctcttctcgctgtcgccgcc
atgcttggtgtcgtttgctcatcgttttatttcttgaagacaaggagacgtttcgaggaa
agccgacctattcgattgacgccgaataatgaataa

DBGET integrated database retrieval system