KEGG   Hippocampus comes (tiger tail seahorse): 109515520
Entry
109515520         CDS       T04969                                 

Gene name
rfwd2
Definition
(RefSeq) E3 ubiquitin-protein ligase RFWD2
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109515520 (rfwd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109515520 (rfwd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hcq04121]
    109515520 (rfwd2)
Enzymes [BR:hcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109515520 (rfwd2)
Ubiquitin system [BR:hcq04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    109515520 (rfwd2)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     109515520 (rfwd2)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 zf_C2H2_10 zf-RING_10 Prok-RING_4 zf-RING_4
Other DBs
NCBI-GeneID: 109515520
NCBI-ProteinID: XP_019724926
UniProt: A0A3Q2Y146
LinkDB
Position
Unknown
AA seq 714 aa
MMSNKRSPQIAGGASSVPSTSSSTSSSGGTGGTANSSGASNAVTSNGNSSVNVVPSRTLA
AAGDSGMSVPSLVAVSSSRGGFASLSRPSASSGSRKRSLHQAPLCNGLLNSYEDKSNDFV
CPICFEMIEEAHMTKCGHSFCFKCIRQSLEDSNRCPKCNYVVDNVDQLYPNFLVNELILK
QKQRSEEKRLKLDHPNGSRWHVFQDVLSPDQENLDLANVNLMLELLVQKKKQLEAESQAA
QRQILMEFLNEARRNKREQLEQLQKELNFLEEDIKRVEEMSGLYSPVEAECTVPNVEAPS
PSPSCSSIMEPSNYNPPPEFGGTNQGKRQTWYNSTLASRRKRLTAHFEDLEQCYFSNKMS
RIAEEGRNLNQLDDFMECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFA
IAGVTKKIKVFEYGTVIQDAVDIHYPVNEMTCNSKISCISWSSYHKNLLASSDYEGTVIL
WDGFTGHRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKAN
VCCVKFSPTSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVNGEEIVSAS
TDSQLKLWNVNKPHCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLT
FKFDTVKSVLDKEKKEDDINEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
NT seq 2145 nt   +upstreamnt  +downstreamnt
atgatgtcaaacaagcggtccccgcagatcgctggcggtgccagttccgtgcccagcaca
agtagcagtacgagtagcagcggtggcacaggaggcaccgcgaactcgagtggcgcaagc
aacgccgtcacgagcaatggaaacagctcagtcaacgtcgtaccctcgcggacactggcg
gctgcaggtgacagcggcatgtcggtgccaagtttggtcgccgtgtcgtcgtctcgcggt
ggcttcgcctccctaagtagaccttccgcgtcctctggcagcaggaagaggtccctccac
caagcacctctttgcaacggcctgttgaactcctatgaagataaaagcaacgattttgtc
tgccccatttgctttgaaatgatagaagaggcacacatgaccaagtgtgggcacagtttt
tgcttcaagtgcattcgccagagtctggaggacagcaaccggtgtcccaaatgcaactac
gttgttgataatgtggatcaactttacccaaactttctcgtaaatgaactcatccttaaa
cagaagcaaagatcagaggagaagcgactcaagttagatcatcctaatggctccaggtgg
cacgttttccaggacgtgttgagtccagaccaggagaacttggacctggcaaatgtcaac
ctcatgttggagctcctggttcagaagaagaagcagctggaagcggaatcccaagcggct
cagagacagatcctcatggagttcctgaatgaagccaggagaaacaagagagagcaacta
gaacaactacagaaggagttgaacttccttgaagaggacattaagcgtgttgaggaaatg
agcgggctgtactctccagtggaggcagagtgtacagtgcccaatgttgaagccccctcc
ccatcgcccagctgtagtagcatcatggagccgtcaaactataacccgccgccggaattt
ggcggaacaaaccaggggaaaaggcagacgtggtataacagcacgctggcatcaagaagg
aaaaggttgactgctcattttgaagatctggagcagtgttacttctcgaacaaaatgtca
cgcatcgcagaggaagggaggaacttgaaccagctggatgactttatggagtgtctttcc
aagtttacacgctacaattctgtgcgacccctggccactctctcctatgccagcgacctc
tacaatgggtcgagcattgtctccagcattgagtttgaccgtgattgcgactactttgcc
atcgccggtgtgaccaagaagatcaaggtgtttgagtatggcacggtgatccaagatgcg
gtggacatccactaccctgtcaacgaaatgacatgcaattcgaaaatcagctgtatcagc
tggagcagctatcacaagaacctcctggccagcagcgactatgaggggaccgtcatatta
tgggatggatttaccggacatcggtccaaagtgtaccaggagcatgagaaacggtgctgg
agtgtagactttaatctgatggaccccaagttgttagcctctggctcagatgacgccaaa
gtgaagttgtggtcaaccaatctggacaactctgtggccagcattgaagccaaggctaac
gtctgctgcgtaaaattcagtccaacgtcccgctatcatctggcctttggctgtgcagat
cactgtgtccattactacgacctccgcaacaccaagcagccgatcatggtgttcaaaggc
caccgcaaagccgtctcctacgccaagtttgttaacggagaggaaatcgtatcagcgtcg
acggacagtcagctgaagctgtggaatgtcaacaaaccgcattgcctgcgctccttcaag
ggtcacattaatgagaagaactttgttggcctggcctcgaatggagactatattgcctgc
ggcagcgagaacaattccttgtacctgtactacaaaggactttccaagacacttttaaca
ttcaagtttgacacggtaaaaagtgtgctggataaagagaagaaggaagatgacatcaac
gagttcgtcagtgccgtctgttggagagccttacccgatggagagtcaaatgtgttgatt
gctgcaaatagtcaaggaacaatcaaggtacttgagcttgtctga

DBGET integrated database retrieval system