KEGG   Hippocampus comes (tiger tail seahorse): 109515737
Entry
109515737         CDS       T04969                                 

Definition
(RefSeq) glucocorticoid receptor-like isoform X1
  KO
K05771  glucocorticoid receptor
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109515737
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hcq03000]
    109515737
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hcq03310]
    109515737
Transcription factors [BR:hcq03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    109515737
Nuclear receptors [BR:hcq03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   109515737
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 109515737
NCBI-ProteinID: XP_019725265
UniProt: A0A3Q2XV63
LinkDB
Position
Unknown
AA seq 756 aa
MDNGEVNITLSRDDCTSKLVYIKSPERSSSLTVAPHSASSSSASIILPSSLLMQPGQSNG
LNSSPAPVEVTSSSITATVSTLQEEPQHKGLTKDQKLVSSSRLNFEEKLMQSGGRTAHLT
PSSMDSLIGGSDPSFFTMKTEDFSLDKIGHDPTDLDHAFEHIGKDIDMNQKLFSDNTLDL
LSDFELTGSPSDFYVGDDAFLSTLADDALLVDVTPEKEIKPVTAESAASSGPLAFNGNNN
IINPDQSSSSVSTTLTSPTTMVKKEKDGDFIQLCTQGVIKQEKMSFCQISSTTSPDLPTS
SPISICGVSTSGGQSFHYGLDSQPLKDQKSVTCQYVPVATVGAPWNRGLTPGPVSGLNKP
SEAFSATPTYRTGFASSTSRPEGTTAPSSTQGKSGTHKICLVCSDEASGCHYGVLTCGSC
KVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLEARKTKKNRVKGI
QPSNSPELLPPKPAEPQALVPKCMPQLAPTMLSLLKAIEPDTLYAGYDNTLPDTLSRVLT
SLNRLGGRQLISAVKWAKALPGFRNLHLDDQMTLLQCSWLFLMSFSLGWRSYRQCNSNIL
FFAPDLIMNEEQMKLPYMVDQCKQMMRISSEFVRLQVSLDEYLCMKVLLLLSTVPKDGLK
SQAAFDEIRMSYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMHEMVGGLLNFCFYTFV
NKSLSVEFPEMLAEIISHQLPKVKAGGVKALLFHQK
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggacaacggtgaagtaaacataacattgagcagagatgactgtacaagtaaactggtc
tacatcaaaagtccagagaggagcagttcattgacagtggcccctcacagtgcaagcagc
tcttcggcctctattattctcccatccagtctattaatgcagcctggacagtctaacggc
ctcaacagcagccctgcgccagtggaagtcacgtcttcctccattactgccactgttagc
acgctgcaggaagagccacaacataagggcctcaccaaagatcagaagctggtctcatct
agccgcctcaacttcgaggagaagttgatgcagtcagggggcagaacagcacacctaacc
ccatcttccatggattcccttatcggaggatcagatcctagctttttcaccatgaaaact
gaggatttctctttggataaaataggtcatgatcctactgaccttgatcatgcttttgag
cacattggcaaagacatcgacatgaaccagaagttattcagtgataacactctggatctg
ctcagtgactttgagctcaccggctccccatcggatttttatgtaggggatgacgccttc
ctgtccaccctagcagatgatgctctgcttgtggacgtcaccccggagaaggaaatcaag
cctgttaccgctgagagcgctgccagcagtggcccccttgctttcaatggcaacaacaac
attatcaatcctgatcagtccagctcaagcgtatccacaaccttaacgtcgcccaccaca
atggtgaagaaagaaaaagatggcgacttcattcagctctgcactcaaggtgtgattaaa
caagagaagatgtctttttgccagataagcagcaccacatcccctgacctgcccacatct
agtcccatctccatctgcggggtgagcacctctggaggtcagagcttccactatggactc
gattcgcagccgcttaaggatcagaagtctgtcacctgccagtatgttcctgttgccacc
gttggtgcaccctggaacagaggactgactcccgggccagtctcaggcttgaataaaccc
tctgaggccttctcagccacccctacctaccgcaccggctttgccagctcgacttcccga
ccggaaggcaccacggcgccgtcgtccacccagggcaagagtggcactcacaaaatctgc
ttggtgtgctccgacgaggcttctgggtgccactacggcgtgctcacgtgtggcagctgc
aaggtgttcttcaaaagagcagtggaagggcaacataattacttgtgtgctggaagaaat
gactgcatcatagataaaatcaggaggaagaactgcccagcctgccgcttccgcaagtgt
ctaatggccggcatgaatctagaagcgcgcaaaaccaagaagaatcgcgtgaaaggcatc
cagccaagcaactcacccgagttgctgcccccgaagccagccgaacctcaggcactcgtc
cccaagtgtatgcctcagctggcccccacgatgctgtcccttctgaaggccatcgagccc
gacaccctctacgcgggctacgacaacaccctgcctgacaccctctcgcgcgtcctgacc
tctcttaacagactgggtggccgacagctcatttctgcggtcaaatgggcgaaggctttg
ccaggtttcaggaacctccacttggatgaccagatgaccctgctccagtgctcgtggctc
ttcctcatgtcatttagcctgggctggaggtcgtaccggcagtgcaacagcaacatcctc
ttttttgctccggaccttatcatgaacgaggagcaaatgaagctgccctacatggtcgac
cagtgcaagcaaatgatgaggattagcagcgagtttgtccgcctgcaggtttcccttgat
gagtatctttgcatgaaggtcctgctgctgctcagcacagtgccaaaagatggcctgaag
agtcaggcggctttcgacgagatacgaatgtcgtacatcaaggaactgggaaaagccatt
gtgaagcgagaggagaactccagccagaactggcaacgtttctaccagctcaccaagctg
ctggactccatgcatgagatggtcggcgggcttctcaacttctgcttttacacctttgtg
aataaatcgctgagcgtggagttcccggagatgctggccgagattatcagccaccagctt
cccaaagtcaaggccggtggcgtcaaagccctccttttccaccagaaatga

DBGET integrated database retrieval system