KEGG   Hippocampus comes (tiger tail seahorse): 109515764
Entry
109515764         CDS       T04969                                 

Definition
(RefSeq) putative fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109515764
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109515764
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hcq04052]
    109515764
   00536 Glycosaminoglycan binding proteins [BR:hcq00536]
    109515764
Cytokines and growth factors [BR:hcq04052]
 Growth factors
  Growth factors (RTK binding)
   109515764
Glycosaminoglycan binding proteins [BR:hcq00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109515764
SSDB
Motif
Pfam: FGF FBD
Other DBs
NCBI-GeneID: 109515764
NCBI-ProteinID: XP_019725320
LinkDB
Position
Unknown
AA seq 155 aa
MIKGNHFMLWSLFPCFFNSIEKFNWHRYTPLPLHNLQLSSYLAANSAAFILMIYVIFSAF
LQLTAVAPSVVVIKGQKTGKYLAMNGEGSLYTSPVANDDCHFLERQMESKYNTYQSQKYR
GKSWYVALKKNGKPELGPNTNIGRKAILFLPRPLH
NT seq 468 nt   +upstreamnt  +downstreamnt
atgattaaaggaaatcatttcatgttgtggtcactctttccatgtttttttaactccatt
gaaaaattcaattggcatcgatacacccccctccccctccacaacctccaactcagctca
tatctcgcagcaaatagtgctgcattcattttgatgatttatgttattttctcagctttt
ttgcagcttacggctgtggctccaagtgtggtggtgatcaaaggccaaaaaacaggaaaa
tatttggccatgaatggggaaggtagtttgtacacttcgcctgttgcaaatgatgactgt
cacttcctggagaggcagatggagagcaaatacaacacctaccagtctcagaagtatcgg
ggaaaaagctggtacgtggcgctgaagaaaaatgggaaacctgagctgggtcccaacacg
aacattggacgaaaggccattttattcctgccccgcccgctgcactga

DBGET integrated database retrieval system