KEGG   Hippocampus comes (tiger tail seahorse): 109516043
Entry
109516043         CDS       T04969                                 

Gene name
siva1
Definition
(RefSeq) apoptosis regulatory protein Siva
  KO
K22744  apoptosis regulatory protein Siva
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109516043 (siva1)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 109516043
NCBI-ProteinID: XP_019725783
UniProt: A0A3Q2YAG8
LinkDB
Position
Unknown
AA seq 167 aa
MPKRAYPFTETFSSQYKVHVRQHELSHSSVLGNKYRKEIYEKTKNLLFNGAKAVVDKVWS
GEERTSDPRASGRETVQSSQTLLRGQTLIGTDGRLTKAIRTQGLPPSGCCVCQKSAPCST
ACSQCERLPCSSCSRKCSNCASLCCSVCTVIDYSGRYDEVLCCSCST
NT seq 504 nt   +upstreamnt  +downstreamnt
atgccgaagcgagcatatccttttacggaaaccttctcgtcccagtacaaagtacacgtc
aggcagcatgagttgagtcattccagcgtgttggggaataaatacaggaaagaaatatac
gaaaagacaaagaacttactttttaatggcgccaaggctgtagtggacaaagtgtggtcc
ggcgaagagaggaccagcgacccccgtgcatctggacgagagactgttcaaagcagccag
actctcttaagaggacagactttgataggaactgacggaagactgaccaaagcaatcagg
acacaagggctgcctccatcaggctgctgcgtatgtcagaagagcgcaccatgcagcaca
gcttgttcgcaatgcgaacgacttccctgttcctcctgcagccgaaagtgttcaaactgc
gcaagcctctgctgttctgtctgcaccgtcatcgattacagtgggcgttatgatgaagtg
ctgtgctgcagttgttccacgtaa

DBGET integrated database retrieval system