KEGG   Hippocampus comes (tiger tail seahorse): 109516072
Entry
109516072         CDS       T04969                                 

Definition
(RefSeq) thrombospondin-1-like
  KO
K16857  thrombospondin 1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04145  Phagosome
hcq04350  TGF-beta signaling pathway
hcq04510  Focal adhesion
hcq04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109516072
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109516072
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109516072
  09143 Cell growth and death
   04115 p53 signaling pathway
    109516072
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109516072
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109516072
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hcq00536]
    109516072
   04990 Domain-containing proteins not elsewhere classified [BR:hcq04990]
    109516072
Membrane trafficking [BR:hcq04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109516072
Glycosaminoglycan binding proteins [BR:hcq00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   109516072
Domain-containing proteins not elsewhere classified [BR:hcq04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   109516072
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 EGF_CA cEGF TSP1_ADAMTS TSP1_CCN EGF Laminin_G_3 Laminin_G_2
Other DBs
NCBI-GeneID: 109516072
NCBI-ProteinID: XP_019725825
UniProt: A0A3Q3DJE8
LinkDB
Position
Unknown
AA seq 1172 aa
MMLRGIFLLLMLCICEGAILAESRDDNSVYDLFDLVRGDNRLNGVTLVKGADPYSPAYKI
LNAELIPPVPDSSFGDLIDSIQLERGFMLLVNLKQSKRNRGSLLTIEKKDGSGPVLEIIS
NGKANTLDVFYSTGNHQQLVSIEEAHLATGHWRKITLFFQDDRVKLLVGCDEINVSEMDE
PIQKVLSQELADIARLRIAKGATRDKFMGVLQNVRFVFGTTLETILRNKGCENGAALTDV
RTLQNAMNGSSPAIRTDYTGHKTKDLQSFCGLSCEDIAGLFKEVRGLGMVVKQVTEELRQ
VSEVSAKIQDQIKNHSSVCIHNGIVHKDRDEWTVDDCTECTCQNSATVCRKISCPLIPCA
NGTVPEGECCPRCGNPNDSSEDDWSPWSQWTRCSVTCGRGIQQRGRSCDRINSNCEGTSV
QTRDCFPQECDKRFKQDGGWSHWSPWSSCSVTCGEGVVTRIRLCNSPTPQMGGKDCQGEG
RQTEICQKKPCPIDGGWGPWSPWDTCTVTCNGGIQNRKRLCSEPVPKYGGKDCVGDATMS
QVCNKQDCPIDGCLSNPCFPGSKCISFPDGSFKCGKCPLGYKGDGITCKDVDECKEVPDA
CYTHNGVHRCENTEPGYNCQPCPARYSGPQPFGRGVEQATAKKQVCKPRNPCQDGSHNCN
KNANCIYLGVFSESMFRCECRPGYAGNGYICGEDTDLDGWPNSDLLCVANATYHCKKDNC
PNLPNSGQEDHDKDGRGDECDHDDDNDGIPDDRDNCPRVYNPSQYDADRDDVGDSCDNCI
FEPNTDQTDTDNNGEGDACAVDIDGDGVLNENDNCPYVYNVDQRDTDRDGVGDHCDNCPL
EHNPDQTDSDSDLVGDKCDNNQDIDEDGHQNNLDNCPYIANANQADHDKDGKGDACDHDD
DNDGIPDDKDNCRLAFNPDQLDSDGDGRGDVCKDDFDQDNVLDIYDVCPENFAISETDFR
RFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFSAVDFSGTFFVNTDR
DDDYAGFVFGYQSSSRFYTVMWKQITQTYWSHTPTRAQGYSGLSIKVVNSTTGPGEHLRN
ALWHTGDTPGQVRTLWHDPKNIGWKDFTAYRWHLVHRPKSGLIRVVMYEGKRIMADSGNI
FDKTYAGGRLGLYVFSQEMVYFSDLKYECRDA
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgatgctgcgtggcatctttctgttgttgatgctgtgcatctgcgagggtgcaatcctg
gcagagagccgtgacgacaacagcgtttacgacttgttcgatctggtgcggggagacaat
aggctcaatggagtgactttggtcaaaggggctgatccgtacagcccggcgtacaaaatt
ctgaatgcggagctgatccccccagtccctgatagttcattcggggaccttatcgactcc
atccagttggagaggggcttcatgctcctggtcaacctgaagcagtccaagaggaacaga
ggaagcctcctgaccattgagaagaaagacggctcgggacccgtgttggagatcatctcc
aacggcaaggccaacactctggacgttttctactccaccggcaaccatcagcagctggtg
tccatcgaggaggcccacttagcgacgggacactggaggaagatcacactcttcttccag
gatgaccgcgtgaaactcttggtgggctgcgatgaaatcaacgtgtccgagatggacgag
cccatccagaaagtcttgtctcaggagctggcggacatcgctaggctcaggattgcgaag
ggagcaactcgggataaatttatgggggtgcttcagaatgtgagatttgtctttgggaca
accctggagacaattctgagaaacaagggatgtgaaaatggagctgccttgactgacgtc
cggactctgcaaaacgcaatgaacggctccagccccgccattaggaccgactacactggc
cacaaaaccaaagatctgcaatcattctgcggcctctcgtgcgaggacatcgcgggtctg
ttcaaggaggtgcgaggactcggcatggtggtgaagcaagtgaccgaggagctgcgtcaa
gtgtctgaggtaagcgccaagattcaagatcaaatcaagaaccacagcagcgtttgcatc
cacaatgggatcgtgcacaaggaccgagacgagtggaccgtggatgactgcaccgagtgt
acctgccagaactctgccactgtgtgtcgaaaaatctcctgccctctgattccctgcgcc
aatggcaccgtgccagagggagagtgctgcccgcgatgtggaaatccaaatgactcttct
gaggacgactggtccccctggtctcagtggactcgctgctcggtgacttgcggtcgtggc
atccagcagcgtggacgctcttgcgatcgcatcaacagcaactgtgagggcacgtccgtc
caaacccgtgactgcttccctcaagaatgtgacaaacgcttcaaacaagacggaggttgg
agccattggtctccctggtcttcatgctctgtgacctgcggggagggagtcgtcactcgc
atacgcctctgcaactctccaacaccccagatgggcggcaaggactgccagggagaggga
cgccaaactgaaatctgccagaagaaaccttgtcccatcgatggaggttggggaccttgg
tcaccgtgggacacgtgcaccgttacatgtaacggaggcatccagaatcgcaaacgactc
tgttctgagcctgttcccaaatacggtggaaaggactgcgtcggcgacgccaccatgtct
caagtgtgcaacaaacaggattgtcccattgacggttgcctctccaacccatgcttcccc
ggctcaaagtgtatcagcttccccgatggctcgttcaagtgcggcaagtgcccgctcggc
tacaaaggagacggcatcacctgcaaagacgttgatgagtgcaaggaggtccccgatgct
tgctatacgcacaatggagtccatcgctgtgagaacacagagcccggttacaactgccag
ccgtgccctgctcgttactccggtcctcagcccttcggaaggggtgtggagcaggccact
gccaaaaaacaggtttgcaaaccacggaacccctgccaggacggtagccacaactgcaac
aaaaacgccaactgcatttacttgggcgtcttctccgagtccatgttccgatgcgaatgc
aggccggggtatgctggtaatggctatatttgcggagaggatactgacctggatggttgg
cccaactctgacttgctatgtgtggccaacgcgacctaccactgcaagaaggataactgc
cccaaccttcccaattctggtcaggaagatcatgacaaggatggccgcggtgatgaatgc
gaccacgacgatgacaatgatggtatccctgatgacagggacaactgcccgagagtgtac
aacccctcccagtatgacgcagacagggacgatgttggtgacagttgcgacaactgtatt
tttgagccaaacactgaccagaccgacactgacaataacggggagggagatgcctgcgcc
gttgatattgacggtgatggcgttttgaatgagaatgacaactgcccatatgtttacaac
gtggaccagagagatacagaccgagatggcgtgggagaccattgcgacaactgccctctc
gagcataaccccgatcagactgactcagattcggatctcgtgggagacaagtgtgacaac
aaccaggacattgacgaggatggccatcaaaacaatttagacaactgcccttacatagca
aacgccaaccaagcagaccacgacaaggacggcaagggcgatgcctgcgaccacgatgat
gacaatgacggtattccagatgacaaggacaattgcaggctggcctttaaccccgatcag
ctggactccgatggtgacggccgaggtgatgtttgcaaagatgatttcgaccaagacaac
gtcctggatatttatgacgtttgcccagagaactttgccatcagcgaaacggacttccgc
cgtttccagatggtcccccttgatcctaaaggaacttcccagattgatcccaactgggtg
gtcagacatcagggcaaggagttggtacagaccgtcaactgcgacccaggcattgccgtt
ggttttgacgagttcagcgccgtcgacttcagcggaacgttcttcgtcaacacagaccga
gatgacgactacgccggttttgtgtttggctaccagtcaagttctcgattctacacagtc
atgtggaagcagatcacccagacctactggtctcacacccccacgagggcgcaaggctac
tcgggtctgtccatcaaagtggtgaactccaccaccggcccgggtgagcacctgaggaac
gcactgtggcatactggagacacaccgggacaggttcgtactctctggcacgacccaaag
aacatcggctggaaggacttcaccgcctacagatggcacctggtccatagaccaaagagt
ggacttattagagttgtgatgtatgagggcaagagaatcatggctgactctggaaacatc
tttgacaaaacctacgccggggggcgactagggttgtacgtcttctctcaggagatggtt
tacttctccgaccttaaatatgaatgtcgagatgcataa

KEGG   Hippocampus comes (tiger tail seahorse): 109523753
Entry
109523753         CDS       T04969                                 

Gene name
thbs1
Definition
(RefSeq) thrombospondin-1
  KO
K16857  thrombospondin 1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04145  Phagosome
hcq04350  TGF-beta signaling pathway
hcq04510  Focal adhesion
hcq04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109523753 (thbs1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109523753 (thbs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109523753 (thbs1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    109523753 (thbs1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109523753 (thbs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109523753 (thbs1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hcq00536]
    109523753 (thbs1)
   04990 Domain-containing proteins not elsewhere classified [BR:hcq04990]
    109523753 (thbs1)
Membrane trafficking [BR:hcq04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109523753 (thbs1)
Glycosaminoglycan binding proteins [BR:hcq00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   109523753 (thbs1)
Domain-containing proteins not elsewhere classified [BR:hcq04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   109523753 (thbs1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 TSP1_ADAMTS EGF_CA Laminin_G_3 TSP1_CCN EGF cEGF
Other DBs
NCBI-GeneID: 109523753
NCBI-ProteinID: XP_019738687
LinkDB
Position
Unknown
AA seq 1167 aa
MKLTGIFLLLMLWTCEGARIAESGEDNSVYDLFELVQVPKKNHGVNQVKGDDPYSPAYKI
LNPDLIPPVPERALRDLIDSIHAERGFLLLLNFKQAKRTRGSLLTVEKKDGSGPIFEIVS
NGKANTLDIVFSTEKKQHLVSIEDADLATGHWKNITLFVQEDRAQLYAGCDEVNNAELDA
PIQSILTQETPDGARLRIGKGAVKDKFMGVLQNVRFVFGTSLDAILRNKGCQSSPDSMMM
ENLNGSSAIRTEYTGHKTKDLQMVCGFSCEDLISMFKELKWLGVVVKELSVELRKLTNEN
KLIKTRIGIHSGVCIHNGIVHKNRDEWTVDDCTECTCQNSATVCRKISCPLIPCANATVP
DGECCPRCGTPSDYAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSVQTRDC
YLQECDKRFKQDGSWSHWSPWSSCSVTCGAGVITRIRLCNSPTPQLGGKDCVGEGRQTEK
CQKSPCPINGNWGPWSPWDTCTVTCGGGVQTRKRLCNDPAPNFNGKDCVGDGKETQTCNK
KTCPIDGCLSNPCFAGVKCTSFPDGSWKCGKCPLGYTGNGVKCKDLDECKEVPDACFEFN
GVHRCENTEPGYNCLPCPPRYSGPQPFGKGVEQAAATKQVCSPRNPCLDGSHNCNKHARC
NYLGHFSEPMFRCECKPGYAGNGHICGEDTDLDGWPNADLVCVENATYHCKKDNCPNLPN
SGQEDYDNDGIGDACDIDDDNDGIPDDRDNCPFTFNSRQYDYDRDDVGDRCDNCPYNSNP
DQTDTDNNGEGDACAVDIDGDGILNEKDNCPYVYNVDQRDTDLDGVGDMCDNCPLEHNPD
QVDSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDDDNDGI
PDDKDNCRLAHNPDQVDSDGDGRGDACKDDFDQDNVPDIYDVCPENFDISETDFRKFQMV
PLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYHEFNAVDFSGTFFINTERDDDYA
GFVFGYQSSSRFYVVMWKQITQTYWSNKPTKAQGYSGLSIKVVNSTTGPGEHLRNALWHT
GNTAGQVRTLWHDPKNVGWKDYTAYRWHLIHRPRTGLIRVVMYEGKKIMADSGSIYDKTY
AGGRLGLFVFSQEMVYFSDLKYECRDT
NT seq 3504 nt   +upstreamnt  +downstreamnt
atgaagctgacggggatatttttgttactgatgctttggacctgtgagggtgccagaata
gcagagagcggagaggacaacagcgtgtacgacttgttcgagctggtgcaagtccccaag
aagaaccacggagtgaatcaggtgaaaggagacgacccgtacagccccgcctacaagatc
ctcaacccggacctgatccccccggtccccgagcgggccctgcgggacctgatcgactcc
atccacgccgagaggggcttcctcctgttgctcaacttcaagcaagccaagcgcacgcgg
ggcagcctcctgaccgtcgaaaagaaggacggctccggtccgatatttgagatcgtgtcc
aatggcaaagccaacacgttggacattgttttctccaccgagaagaagcagcatttggtc
tccatcgaagatgcggatctcgcgacgggccactggaagaacatcacgctgttcgtgcag
gaggaccgggcgcagctgtatgccggatgcgacgaggtcaacaacgccgagctggacgcg
ccgatccagagcatcctgacccaggagacgcctgacggcgcgcggctcaggatcgggaaa
ggagccgtgaaggacaagttcatgggggtccttcaaaacgtccgctttgtttttggaaca
agcttggacgccatcctccgcaacaaaggatgtcaaagctcgccagattcgatgatgatg
gagaatcttaatggctcgtccgccatcaggacagagtacactggccataaaactaaagat
ctgcagatggtctgcggtttctcctgtgaggacctcatcagcatgttcaaggagctcaaa
tggcttggcgtggtggtcaaggagctgtccgttgagctacgtaaactgacaaatgaaaac
aagctgattaagacgcgcatcggcatccacagcggcgtctgcatccacaacggcatcgtg
cacaagaacagagacgagtggaccgtcgatgactgcaccgagtgcacttgtcagaactct
gcaacagtgtgtcgcaagatctcctgtcccctgattccctgtgccaacgcaactgtaccg
gacggagagtgttgcccacgctgtggaacaccgagcgactacgcagaggacggctggtct
ccgtggtctgaatggacccattgttccgtgtcatgtgggcggggcatccagcagcgcgga
cgctcttgcgaccgtatcaataacaactgcgagggcacctccgtgcagacgcgggactgc
tacctccaagagtgtgacaagcgcttcaagcaggatggcagctggagccattggtcgccg
tggtcctcatgctccgttacctgcggggcaggcgtcatcactcgaatccgtctctgcaat
tccccaaccccccagctcggaggcaaggactgtgtgggagaaggtcgccaaacagaaaag
tgtcaaaagtctccatgccccatcaatggcaactggggtccctggtcaccgtgggatacg
tgcaccgttacgtgtggaggcggcgtgcaaactcgtaaacgcctgtgcaatgaccctgcg
ccaaattttaatgggaaagattgtgttggagacggcaaagaaacgcaaacatgcaacaag
aaaacgtgtcctattgacgggtgcctatcaaacccttgtttcgctggggtcaagtgcacg
agttttcctgatggttcctggaagtgtggaaaatgccctcttggttataccggcaatggt
gtcaaatgcaaagacctcgacgagtgcaaggaggtccccgatgcttgcttcgagtttaac
ggcgtacaccgctgcgagaacacggagcccgggtacaactgtctcccctgtccgcctcgt
tactctggacctcaaccgtttgggaaaggtgtggagcaggctgctgctactaaacaggtg
tgctcgccccgaaatccgtgcctggatggaagccacaactgcaataaacacgcgcgctgt
aactacctcggccatttctcggaacccatgttccgatgcgagtgcaagccgggctacgct
ggcaacggacacatctgcggagaggacaccgatctggatggttggcccaatgctgacttg
gtttgtgtggagaatgccacctaccactgcaaaaaggacaactgccccaacctccccaac
tccggccaagaagattatgacaacgacggcattggagacgcttgtgacattgacgatgac
aacgacggcattcctgatgacagggacaactgtccgttcaccttcaactccaggcagtat
gactacgaccgtgatgacgtgggcgatcgctgtgacaactgcccttataatagcaaccct
gaccaaacagacacggacaacaacggggagggagatgcctgcgccgtggacatagatggc
gatggcatactgaatgaaaaggacaactgtccctatgtgtacaatgtggaccagagagac
accgatttggatggggtgggcgacatgtgcgataactgccctctggaacataatcctgat
caggtggattcagatgacgaccgtgtgggagacaagtgtgacagcaaccaggacattgat
gaggacggacaccagaacaacctggacaactgcccgtacatccccaacgccaatcaggcc
gatcacgacaaggacggcaagggagatgcgtgtgaccacgatgacgataatgacggcatc
cccgacgacaaggacaattgcagactggcacataatcctgaccaggttgactccgatggc
gacggccgtggagatgcatgcaaagatgactttgaccaagacaacgtgcctgacatctac
gacgtgtgtccggagaactttgacattagcgagacagacttccgcaaatttcagatggtt
cctctcgacccgaagggcacttcccagattgatccaaattgggtggtgcgtcaccagggt
aaagagctcgtccaaaccgtcaactgtgaccctggaattgccgttggatatcatgagttc
aatgcggtggacttcagtgggaccttcttcatcaacaccgagagggatgacgactacgcc
ggctttgtgtttggttatcagtccagctccaggttctacgtggtgatgtggaagcagatc
actcagacctattggtccaataaacctaccaaagcccagggctattctggcttgtcaatc
aaagtggtcaattccaccaccggcccgggagagcacctcaggaatgccctgtggcatacc
ggcaataccgcaggacaggtccgcactctctggcatgaccccaagaacgtcggatggaaa
gattacacggcctacagatggcatctgatccacagaccgagaacggggcttatcagggtt
gtgatgtacgaaggaaagaagatcatggcagattccggcagcatctatgacaagacgtat
gccgggggaaggttaggtctttttgtcttctcccaggagatggtttacttctcagacctc
aagtatgagtgccgagatacataa

DBGET integrated database retrieval system