KEGG   Hippocampus comes (tiger tail seahorse): 109517427
Entry
109517427         CDS       T04969                                 

Gene name
atr
Definition
(RefSeq) serine/threonine-protein kinase ATR isoform X1
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq03460  Fanconi anemia pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    109517427 (atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109517427 (atr)
   04115 p53 signaling pathway
    109517427 (atr)
   04218 Cellular senescence
    109517427 (atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109517427 (atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109517427 (atr)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109517427 (atr)
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   109517427 (atr)
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109517427 (atr)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC HEAT HEAT_2 AAA_lid_2 DUF4838 Mononeg_mRNAcap V-ATPase_H_C
Other DBs
NCBI-GeneID: 109517427
NCBI-ProteinID: XP_019728157
LinkDB
Position
Unknown
AA seq 2584 aa
MEGLEMSAMIPALRELASASPGEYDEAAKKPRQILCQFIDRILTDVDAVSLGLNKKSTSE
PACVMLLDFVQHIIKSSSLMFSNPACQSADYPDTTQHCIDFGKWVLLRLLRVAAAPDCGA
IHGKVRAVLCSLLHSFLVRMPFIFARLAQGLILLVADLSGILHAHITSRSPSLWPAALQS
FTVPPPCPNLTPSTLSLASPAALESLAAVTLYVVSDVVRGVISPRDQRMAWETACAILAN
GNTRLRTVTMAMLRRLVELRGFPEELGHQFFATFLHVLKTHAGGYEGELLSLAHCVFRQG
CTRLEDTYLAQVFECVCTHAETQASNTRTLEPGTPQGTEVTQSVCHALDWALSVAISYEN
VALLQMRRVVQVCGTLARTVGTETQAECAEGFLKAALKAEIAMLMRQFEDEATPSKKVCK
GAHGTPNSVPYAEVAVRDDSEVWAVLSSRLEELLALFNSDNCELKSAHRLAALRGVGLIL
RLAAVCSSPTRQPPLLWLSSETLGRTLRSCQSVLEGGAEPVSNQNYYESAVQITMRVLDC
VLYLTACSQGQDVLHRHACALLTLPWVSAHKSTSAYKNTGFHSWVLTLAQRLHFCFSSKV
RTQCLSLVAHLHGGVCAAWRAFVFSAALRGRDEALKEAAVRAFPLLLHHLENSQHNLITT
TALYPMLDDSSENVRRELARIVGHLSCVQSGLSLLSYDANHAEELVCHGLCLAVEHLGGA
PPSLTASFVKPFLLLLGPLAPSSVKQAFLQALPHLCQHVRLGDAGDDSQELLSALIGLLK
DSDPGVRMSFSQSVRFLLMDPSPDNSPASELLTVALKEAFNSAKANNDDNLRHTLILTTG
EIGRTSQGSLVSFSLLHLLHCLLSKSSPVSVGAYTQIRSLAASKGIELQTLFNQHKNPIC
QFLVESLHSRYSSATRSMPQQGNDSAHQRELALDILAQIAHAFNFPDLHLFLSRTLQVLL
PYLAAKSSVIGSALIRTLANELNANRREILISNFKYIFSHLVCSCTKEELERAFHYLQSE
TEIELGSLLRQDFQGLHNELLLRLGEHYQQVFNGLAILASFASNDDPYQGPRNITTSEQM
VDYLQPKLLGILAFFNMQFLSSRAGEKDRKKLALTSVMALMRLMGSKHISSVRVKMMTTL
RTGLRYREDFPLLCCQTWECFVRSVETAHLGPLLSHVIVALLPLIPLQPKETAAIIRFLI
LDNREEVNDYLHEIYFLPDHPELKDIHTVLQNYKKLTASNSDLASALQLSMRAVQHENVD
VRIHALTSLRDMMHSNQEWLSRQVCASESVEPVISSLVSVLLKGCQDSSPEARLLCGECL
GELGAVDPGRLDLSPSHIHGDRNTFVGGVADPNFAYELLTELTRAFLAYADNVRAQDSAA
YAIQELLAIFECREGRLDSPGRRLWRRFPEHVKEILEPHLNSRYKSSQKKAAWSNLKKPV
YLSNRGGKFSDWAATWAAYLISKVRHNLASRVFTCCSFIINYDYKVTIYLLPHVLLYMLL
GCTPAEREEVTQEMLAVLTESEERVQETASSHWQLSTQTVFSMLSHLTQWSRHISHVEPS
DNAESGKYKCVAAFLKDIPQDVMAKAALHSKAYTRALMHFEAYMLEGNEDIKDHLTFLQT
LYAAMHEPDGLKGVDALRQEEPSLREQILEHESIGLLQDATACYDHAIQLQSDQIGHYHG
VMRSRLGLGQLSTVITQVNGVLADREQWTSELNAYRVEAAWKLGKWDLLEDYLSSDLQSS
TWGVRLGQLLLAAKKQDGAAFSEKLKLVRNEQVVPLSAASYECGSYQRGYEYIVRLHMLS
ELEHTFTELQRQEGGSSPGLRQLPSHWSDRLEMTQKSFRAKEPILALRRALLSLQSKPSS
QKLVGECWLQSARVARKAGHHQTAFNALLNAENTHLAELLTEKAKWLWSKGDVHQALIVL
QKGVAQCFPNEEPPSDPHDLQTKGRAMLLVGRFMEETANFESNAVMKTYKDVTNLLPEWE
DGNFYLAKYYDKVMPMVTDNKMEKQGNLIRYIVTYFGKALQFGNQYIYQAMPRMLSLWLD
FGAKVCECEKAGRADRQMRQELSKINAMMGEHCANLAPYQFLTAFSQLISRVCHSNDEVF
TVLMTIVAKVFLAYPQQAMWLMTAVSKSSYPTRMNRCNQILKKAISLKQSLDKFVSDANR
LTDKLVELCNKLVNNDTGKLSMSVHFKHLKRLVEEPTFSQILIPLQSVLIPTLPYTGGAN
TTHDAFPGHWVYLDHFEDHVEILPSLQKPKKISLKGSDGRSYTMMCKPKDDLRKDCRLME
FNCLINKCLRKDAESRRRELHIRTYAVIPLNEECGIIEWVNNTSGLRHILTRLYKERGVY
LSGKDLKKMILPKTTPFEEKLRMHKDVLCARHPPIFYEWFLRTFPDPTSWYNSRSVYCRS
TAVMSMVGYVLGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFDVPEVVPFRLTQNMV
HAMGPMGIEGLFRQACEVTLRLMRDQRESLMSVLKTFLHDPLVEWSKQGKGLCKIQANET
GEILNEKAKTHVCDIEQRLQGVIKSRNKVLGLPLSIEGHVHYLIQEATDDKLLCLMYVGW
GPYL
NT seq 7755 nt   +upstreamnt  +downstreamnt
atggaggggctggagatgtcagccatgatccccgctcttcgtgagcttgccagcgccagt
ccgggggaatacgacgaagctgcaaagaaacctcgacagatcctgtgtcagttcattgac
aggatactgactgacgtggatgcggtgtctctcgggctgaataaaaagtccacctcggag
cctgcctgcgtcatgctgctggacttcgtgcaacacatcatcaagtcgtcatcactcatg
ttttccaaccctgcctgccagtccgcagactaccccgatacaacacaacactgcattgac
ttcggcaagtgggtgttactgcgtctgctgcgcgtggctgccgcccccgactgcggcgct
atccacgggaaggtgcgcgccgtcctttgctccttgctgcactccttcctcgtccggatg
cccttcattttcgcccgcctggcccaagggctcatcctcctggtggccgacctgagcggt
atcctacacgcccacatcacctcccgctcgccaagcctttggcccgccgccctccaatcc
ttcaccgtccccccgccgtgccccaacctcaccccttcgaccctctctctcgcctcaccg
gctgcgttggagtccctcgccgcggtgacgttgtacgtcgttagcgacgttgtcaggggt
gtaatctccccacgggaccaaagaatggcctgggagaccgcctgcgccatcctggccaat
ggtaacacccggctgaggactgttaccatggcgatgctgaggcggctagtggagctgcgg
ggcttcccagaagagctgggacaccagttcttcgccaccttcctccacgtgctgaagacg
cacgctggcgggtatgagggggagctgctcagcctcgcacactgcgtgtttcgccaaggt
tgcacccgcctggaggacacgtacctggcacaagtgtttgaatgtgtctgcacccatgcg
gagactcaggcgtccaacacaagaaccctggagcctggcactccccaggggacggaggta
acccagtctgtgtgtcatgctttggactgggcgctgtcagtcgccatcagttatgagaac
gtcgccctactgcagatgaggagagtggtgcaggtctgcgggacgctggcgcgcaccgtt
ggaactgaaacacaagctgaatgtgcggaaggtttcctgaaagctgcgctcaaagcggag
attgccatgctgatgcgccaattcgaagacgaggccacgccgagcaagaaagtctgcaaa
ggggcccacggcacaccgaactcggtgccgtacgccgaagtggccgtacgtgatgacagt
gaggtctgggccgtgctcagcagccgcttagaggagctcttggcgctgttcaactctgac
aattgtgaactcaagagcgcccacaggcttgccgcgcttcggggcgtcgggctcattctc
cgactggctgcagtttgttcctcgcccaccaggcagccgccacttctctggttgtcctct
gagactctgggtaggacattgaggagctgtcaatcagtgctagagggcggggctgaaccc
gtctccaaccagaactactacgagtccgctgtccagatcactatgagagtccttgactgt
gtgctctacctgaccgcgtgcagccaaggtcaagatgtgctccatcggcatgcgtgtgcg
ctcctgacgctcccctgggtgtcggctcacaagtcgacttcggcctacaaaaatacgggt
ttccactcctgggtgctcaccttggctcagaggcttcacttttgcttctcgagcaaggtt
cggacgcagtgtctctctctggtggcgcacttgcacggcggggtgtgcgcggcgtggcgt
gcgtttgtgttctctgcggccctgcgaggtcgggacgaggccctgaaagaggcggcggtc
cgggccttcccgcttcttcttcaccatctggaaaactcccaacacaacctcatcaccacc
accgccctatatccaatgctggatgactcttcggagaatgtgcgaagggagctggcgagg
atcgtgggccatctgagctgcgtccagtcggggctgtccctgcttagctacgacgccaat
catgcggaagagcttgtgtgccacggcctctgcctggcggtggaacacctcggcggcgca
cccccatccctgacagcatcctttgtcaaacctttcctgcttctgctcggaccactggcg
ccaagtagcgttaaacaagcatttctacaagcactacctcacctctgccaacatgtccgt
ctgggtgatgctggcgacgactcccaggagcttttgtccgctctcatcggccttctcaag
gattcggatccgggcgtcaggatgagtttcagccaatcggtgcgtttcctgttgatggac
ccctcccctgacaacagccccgcgagtgagctgctgactgttgcgctcaaagaggccttc
aacagcgccaaagccaacaatgacgacaacttgcgccacactctcatcctcaccaccgga
gagatcggcagaacatctcagggcagcttggtgtccttctccctgctgcatctgctccac
tgtttgctgtccaagtcgtcgcccgtgtctgtgggtgcctacacacagatcagatcgctg
gcggcctccaaaggaatcgagttgcaaacactcttcaatcaacacaagaaccccatttgt
cagttcctggtggagtcgctgcactcgcgttactcttcggccacgcgcagcatgccccaa
cagggcaacgattctgcccatcagagggagctggcgcttgacatccttgctcagatcgca
cacgccttcaacttcccagacctccacctctttctttctcggacgctgcaggtgctcttg
ccctacttggccgccaagtccagcgtcattggttccgccctcatccgcacgctggccaat
gagctgaacgccaaccggcgggagatcctgatcagtaacttcaagtacatctttagccac
ctggtctgctcctgcacgaaggaggagctggagagggccttccactacctccagagcgag
accgagatcgaactgggctcacttctgcgccaagacttccaaggccttcacaacgagcta
ctgctgcgcttgggtgagcactatcagcaggtcttcaacggcctggccatcctggcttcc
ttcgcgtccaacgacgacccctaccagggtccccgcaacatcaccacctcggagcaaatg
gtagactacctgcagccaaagctactaggaattcttgctttctttaacatgcagtttctc
agctctcgagcgggagagaaggacaggaagaaactggcgctgaccagcgtgatggcactg
atgcgactgatggggtccaaacacatcagctcagtgcgggtgaagatgatgaccaccctg
cgcaccggcctccgctatcgagaagactttcctctgctctgctgccaaacgtgggagtgt
ttcgtgagaagcgtggagacggcacatcttggccccctgctgagccacgtgattgtggcg
ctcctgcctctcatccccctgcagcccaaagagaccgctgccatcatccgcttcctcata
ctggacaacagggaagaggtcaacgactacctccatgagatttacttcctgccggaccat
cctgagctcaaagacattcacactgtgctgcagaactacaaaaagttgacagcaagcaac
agtgacctggcgtctgcattacaactttccatgagagccgttcagcacgagaacgtcgac
gtccgcatccatgcactgaccagcctcagagacatgatgcacagcaaccaggagtggctg
tcgaggcaagtgtgcgccagtgagtctgtggaaccggtcatctccagcctggtgtcggtg
ctgctcaagggctgccaggactcgtctcccgaagcccgactcctgtgtggcgagtgtctc
ggtgagctgggcgctgtggatccgggtcgcctggacctatcgccgtcgcacatccacggt
gaccgcaacacctttgtgggtggcgtggccgaccccaattttgcttacgaactgctgacc
gaactcacccgagctttcctggcttatgccgacaacgtccgagcgcaggactctgctgcg
tacgccatccaggaactgttggccatctttgagtgccgcgagggtcgcctggattcaccg
ggccgccgactgtggaggagattcccggagcatgtcaaagaaatactggagcctcacctc
aacagcaggtacaagagcagccagaagaaggctgcctggtccaacctgaagaagccagtc
tacctcagcaaccggggcggcaagttctccgactgggccgccacgtgggccgcctatctc
atcagcaaagtacgacacaatttggcaagccgggtgttcacctgctgcagtttcatcatc
aactacgactacaaggtgaccatctacctgctgcctcatgtgctgctctacatgctgttg
ggctgcacgccggccgaacgagaggaggtgacacaggagatgctggccgtgctgacagag
agcgaggagcgtgtccaggagacggcgtccagccactggcagctcagcactcagacggtg
ttcagcatgctgtctcacctcacccagtggagtcgccacatcagtcacgtggagcccagc
gataacgcagagagtggcaagtacaagtgcgtggcggctttcctcaaggacatcccgcaa
gatgtgatggccaaggcggcgctgcattccaaggcctacacgcgcgccctcatgcacttt
gaagcctacatgctggagggcaacgaggacatcaaggaccacctcaccttcctccagaca
ttgtacgctgccatgcacgagcccgacggcctgaagggggtggacgccctgaggcaggag
gagccgtcgctccgcgaacaaatcctggagcacgagagcatcggcctgctgcaggatgcc
accgcgtgctacgatcacgccatacagctccagtccgaccagatcggccactatcacggc
gtcatgaggtctcggttgggcctgggccagctgtccacagtcatcacgcaggttaatgga
gtcctggccgacagggagcagtggacctcggagctcaacgcctacagagtggaggctgcc
tggaagctgggcaaatgggacctgctggaggactatttgagttcggacctccagtccagc
acgtggggagtacgactgggtcagctgctactggcagccaagaaacaagatggcgccgcc
ttctccgagaagctgaagctggtccggaatgagcaggtggtcccgttgtcggccgccagc
tacgagtgcggctcttaccagagaggatacgagtacatcgtcaggctccacatgctgagc
gagttggagcacacgttcaccgagctacagaggcaggagggaggctcgtctcccggcctc
agacagctcccctcccattggtcggatcggctggagatgacccagaaatcatttcgggcc
aaagagcccatcctggccctccgccgcgccctgctgagcctgcagtcaaagccttcgagt
cagaagctggttggcgagtgctggctccagagcgcccgggtggccaggaaggccggacat
caccagaccgccttcaacgcgctcctgaacgcagagaacacgcacctggctgagctgctc
accgagaaggccaagtggctttggtccaagggcgacgtccaccaggcgctgatcgtactg
cagaagggcgtggcccagtgcttccctaacgaggagcccccgtcggaccctcacgacctg
cagaccaaaggccgagccatgctgctggtgggccgcttcatggaggagacggccaacttt
gagtccaacgccgtcatgaagacgtacaaggatgtgaccaaccttctgcctgagtgggag
gacggcaacttctacctggccaagtactatgacaaagtcatgcccatggtgaccgacaac
aagatggagaagcaagggaacctcatcagatacattgtcacctatttcggaaaagcgctg
cagtttggaaaccagtacatctaccaagctatgccccgtatgctctccctctggctggac
tttggagccaaagtgtgtgaatgtgagaaagctggtcgggccgacaggcagatgcgccag
gagctgtccaagatcaatgcgatgatgggcgagcattgcgccaacctggctccctaccag
ttcctcaccgccttctcgcagctcatctcccgcgtgtgccactccaacgacgaagtcttc
accgtcctcatgaccatcgtggccaaagtcttcctggcgtatccgcagcaggccatgtgg
ctcatgacggccgtgtccaagtcgtcctaccccacccgcatgaatcgctgcaatcagatc
ctgaagaaagccatcagcctcaagcagtctctggacaagtttgtcagcgacgccaacagg
ctcaccgacaagctggtggagctctgcaacaagctggtaaacaacgacaccggcaaactg
agcatgagtgtccacttcaagcatctgaagcgtttggtggaggagcccaccttcagccag
attctcatcccgctgcagtctgtgctcatccccacgctgccctacaccggcggggccaac
accacccacgacgccttcccgggacattgggtctacctggaccactttgaagaccacgtg
gagatcttgccctccttgcagaagcccaagaagatcagcctgaagggctcggacgggcgc
agctacactatgatgtgcaagcccaaagacgacctgaggaaggactgcaggctcatggag
ttcaactgtctcattaacaagtgcttgcgcaaagacgccgagtcacggcgccgggagcta
cacatccgcacctatgccgtcatccctctgaacgaggagtgcggcatcatcgagtgggtc
aacaacacgtcggggctccgccacatcctcaccaggctgtacaaggagagaggcgtctac
ttgtcgggcaaggatttgaagaagatgatcctccccaagacgacccccttcgaagagaag
ctccgcatgcacaaggatgtgctgtgcgctcgacacccccccatcttctacgagtggttc
ctgcgcaccttccctgaccccacgtcgtggtacaacagccgctccgtatactgccgctcc
acagccgtcatgtccatggtgggctacgtcctcggcctgggggaccgccacggcgagaat
atcctctttgactccttcacgggggagtgtgtgcacgtggacttcaactgcctctttaat
aagggggagacgtttgacgtccccgaggtggtcccattccgtctgacgcagaacatggtg
cacgccatggggcccatgggcatcgagggtctcttcaggcaggcctgcgaagtcacactg
aggctgatgagggaccagagggagtcactcatgagtgtcctaaaaaccttccttcatgat
cccctggtggagtggagcaaacaaggcaaaggactctgcaaaattcaggccaacgaaact
ggagagatcctcaacgaaaaggccaaaacgcacgtgtgcgacatcgagcagcgtctccag
ggtgtgattaagagccgcaataaagttctgggactgcctctgtccatcgagggccacgtg
cactacctgattcaggaggccacggacgacaagctgctctgtctgatgtatgtgggctgg
gggccctacctgtaa

DBGET integrated database retrieval system