KEGG   Hippocampus comes (tiger tail seahorse): 109517452
Entry
109517452         CDS       T04969                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like isoform X1
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109517452
   04068 FoxO signaling pathway
    109517452
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109517452
   04210 Apoptosis
    109517452
   04115 p53 signaling pathway
    109517452
   04218 Cellular senescence
    109517452
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hcq03036]
    109517452
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109517452
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109517452
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109517452
NCBI-ProteinID: XP_019728193
LinkDB
Position
Unknown
AA seq 160 aa
MSPEGSLTSSVTENRMQSVGVALEELLVTAQKQECLTVGIYESAQFLNTDPDSVVLCVLA
ADGDEADVALQIHFTLLQSFCCDSGITILRVSGVPRLRRLLASVDDNDDDEDNRRQDGDI
HCMLVTNPQADHCRLREVGIYCQESLRVDQWVPELVLQDR
NT seq 483 nt   +upstreamnt  +downstreamnt
atgagtccggaggggagcttgacttccagcgtcaccgagaacaggatgcagtcggtaggc
gtggcgctggaggagctgctggtgacggctcagaaacaagagtgcctgaccgtcggcatc
tacgagtccgctcagtttctcaacacggatccggacagcgtggtcctgtgcgtgctggcc
gccgatggcgacgaggcggacgtggctctgcaaatccacttcacgctactgcagtcgttc
tgctgcgacagcggcatcaccatcctgcgcgtgtccggcgtaccgcgactacgccggctg
ctcgccagcgtggacgacaacgacgacgacgaagacaaccggcgccaggacggagacata
cactgcatgctggtcacgaacccccaggctgaccactgccgtctccgggaagttggcatc
tactgccaggagagcctccgcgtggaccaatgggtccccgagctggtcttgcaggatcgc
tga

KEGG   Hippocampus comes (tiger tail seahorse): 109517509
Entry
109517509         CDS       T04969                                 

Gene name
gadd45g
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109517509 (gadd45g)
   04068 FoxO signaling pathway
    109517509 (gadd45g)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109517509 (gadd45g)
   04210 Apoptosis
    109517509 (gadd45g)
   04115 p53 signaling pathway
    109517509 (gadd45g)
   04218 Cellular senescence
    109517509 (gadd45g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hcq03036]
    109517509 (gadd45g)
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109517509 (gadd45g)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109517509 (gadd45g)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109517509
NCBI-ProteinID: XP_019728267
UniProt: A0A3Q2ZE93
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEIRGQENTMEHNERVQSAGTALEELLLAAKKQDYLTVGVYESAKVMNVDPDSVAFC
VLATDQEHACDIALQIHFTLIQAFCFDNDINVVRVTDIERLADLVGADEGGEPKDAHCIL
VTSPSANPWKDPALDKLSLFCEQSRSMCDWVPTITFPER
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactcttgaggagattcgcggacaggaaaacacgatggaacacaatgagagggtgcaa
agtgcaggcacagcactggaagagctgctgctcgccgctaagaagcaagactacctaaca
gtcggcgtttacgagtcggctaaagtcatgaatgtcgacccggatagcgtcgccttctgc
gtgctcgccaccgaccaggagcacgcgtgcgacatcgccttgcagatccacttcacgctc
atccaggcgttctgcttcgataacgacatcaacgtggtgcgcgtcaccgacatcgagcgc
ctcgccgacctggtgggcgccgacgagggcggcgagcccaaggacgcccactgcatccta
gtcacgagcccaagtgccaatccatggaaagaccccgctctggacaagctgagtcttttc
tgcgagcagagccgcagcatgtgtgactgggttcccaccatcaccttcccggagcgctga

KEGG   Hippocampus comes (tiger tail seahorse): 109523932
Entry
109523932         CDS       T04969                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109523932
   04068 FoxO signaling pathway
    109523932
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109523932
   04210 Apoptosis
    109523932
   04115 p53 signaling pathway
    109523932
   04218 Cellular senescence
    109523932
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hcq03036]
    109523932
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109523932
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109523932
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109523932
NCBI-ProteinID: XP_019738985
LinkDB
Position
Unknown
AA seq 156 aa
MTLEEVLRQKSTEAERAHCTGKALEEVLVTAMDNDALTVGVYECAKVMNLDPDSVSFCVL
AVDEGFECDIALQIHFTLIQSFCFDNDISIVRVSDLQRLAEIVADKPEQLEDAHCVLITN
PADGAWEDPSLEKLHLFCEESRRLNDWVPEVSLPGR
NT seq 471 nt   +upstreamnt  +downstreamnt
atgactcttgaggaagttctgaggcagaaatccaccgaggccgagcgtgcacattgcacc
ggcaaagccctggaagaggtgctggttaccgccatggacaacgacgccctcaccgtggga
gtgtacgagtgcgcaaaagtgatgaatctcgacccggacagcgtgtccttctgcgtgctg
gccgtggatgagggtttcgagtgtgacatcgctttgcagatccacttcaccctcatccag
tccttctgcttcgacaacgacatcagcatcgtccgagtgagcgacttgcagcgtctggct
gagattgttgccgacaagccggagcagctcgaagatgctcactgcgtcctcatcacgaac
ccggcggacggggcttgggaggacccctctctagagaagctgcacctgttctgcgaggag
agccggcgtctgaacgactgggtccccgaggtcagcctccccggacgctga

KEGG   Hippocampus comes (tiger tail seahorse): 109523962
Entry
109523962         CDS       T04969                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109523962
   04068 FoxO signaling pathway
    109523962
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109523962
   04210 Apoptosis
    109523962
   04115 p53 signaling pathway
    109523962
   04218 Cellular senescence
    109523962
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hcq03036]
    109523962
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109523962
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109523962
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109523962
NCBI-ProteinID: XP_019739047
LinkDB
Position
Unknown
AA seq 123 aa
MQSPGKSLKEALLCAQSEARLTVGVYESAKIMTDDPDSVSFCVLAVDEGFECDIALQIHF
TLIQSFCFDNDISIVRVSDLQRLAEIVADKPEQLEDAHCVLITVGTAHQSAAKLADAGSG
SSL
NT seq 372 nt   +upstreamnt  +downstreamnt
atgcagtctcctggaaaatctctgaaggaagccctgctctgtgctcagagcgaggctcga
ctcaccgttggagtctatgaaagtgccaaaataatgactgacgacccggacagcgtgtcc
ttctgcgtgctggccgtggatgagggtttcgagtgtgacatcgctttgcagatccacttc
accctcatccagtccttctgcttcgacaacgacatcagcatcgtccgagtgagcgacttg
cagcgtctggctgagattgttgccgacaagccggagcagctcgaagatgctcactgcgtc
ctcatcacggttggtacagctcatcagtcggctgcaaaacttgctgacgcgggatcgggc
tcctctctgtga

KEGG   Hippocampus comes (tiger tail seahorse): 109524174
Entry
109524174         CDS       T04969                                 

Gene name
gadd45a
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha isoform X1
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109524174 (gadd45a)
   04068 FoxO signaling pathway
    109524174 (gadd45a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109524174 (gadd45a)
   04210 Apoptosis
    109524174 (gadd45a)
   04115 p53 signaling pathway
    109524174 (gadd45a)
   04218 Cellular senescence
    109524174 (gadd45a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hcq03036]
    109524174 (gadd45a)
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109524174 (gadd45a)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109524174 (gadd45a)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109524174
NCBI-ProteinID: XP_019739396
UniProt: A0A3Q2YJM4
LinkDB
Position
Unknown
AA seq 170 aa
MYNMTFEEISGDNSQERMDSVAKALEDVLTRALPQGCITVGVYEAAKSLNVDPDNVVLCI
LAADDEDVKDVALQIHFTLIQAFCCENDINILRVNNTRRLAQILAAGGGGGGGGGGGKQS
GGEPVDLHCVLVTSPESSSWKDPALSKVNLFCRESRCMDQWVPIINLPER
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtacaacatgacatttgaggaaataagtggggataactctcaagaaagaatggactcg
gtggcgaaagcgttagaagatgtcctgaccagagccttaccgcagggctgcataactgtg
ggcgtctacgaggcagcaaagtccctcaatgtggaccccgacaatgtggtcttgtgcatc
ttggcggccgatgacgaagatgtgaaagacgtggccctgcagatccacttcacgctcatc
caggctttctgctgcgagaatgacatcaacatcctgagagtgaacaacacccggcgcctg
gctcaaattctggcggcgggtggaggaggaggcggaggaggaggaggaggaaagcaaagt
gggggcgagcctgtggacctgcactgtgtgcttgtcactagccccgagtcgtcctcgtgg
aaggaccccgcgttgagcaaagtgaacctcttctgcagggagagccgctgcatggatcag
tgggtgcccatcatcaacctacccgagcgatga

DBGET integrated database retrieval system