KEGG   Hippocampus comes (tiger tail seahorse): 109517893
Entry
109517893         CDS       T04969                                 

Definition
(RefSeq) glucocorticoid receptor-like isoform X1
  KO
K05771  glucocorticoid receptor
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109517893
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hcq03000]
    109517893
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hcq03310]
    109517893
Transcription factors [BR:hcq03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    109517893
Nuclear receptors [BR:hcq03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   109517893
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR
Other DBs
NCBI-GeneID: 109517893
NCBI-ProteinID: XP_019728926
UniProt: A0A3Q2ZGR2
LinkDB
Position
Unknown
AA seq 786 aa
MDQGILKCNSNRDDSLTFIELGTGECKEAADATGSLLSALHPISPNGGGTKDQLEPGSLL
DSHQQRQALFEGSNTNDQKMVRIEKRQQDVGVFNIEEDLALLSQNIADLDNVSSSVINTS
VLGNLPLPDLFPQHIKQEVDFSLDKELGSYGGLPSATSCDLTGGTRLIEDSELWKDLDLP
GSLPEISDFELDSEVAHLDNILHDDGRPVGGLPKATQVLTGNGGNCYANGTGQQHHNMLH
PPHQQHHLLQHQVQHQVHPQHQQPASLLSSVVIKEENPDNPFAHIRTPSMVKQEKQEPVF
CQAQCLQGGMGSVHLGAPMSSSMSVDAAGYRCRTNAPSTMGQQPREPFAMHSNLSSLGES
WMRGDGYGESTAIQRTNDGLPNTSMLMSYPLSFSSSTPRAGAESNSSVVPGQSKPNGQTH
KVCLVCSDEASGCHYGVVTCGSCKVFFKRAVEGWRARQKSDGQHNYLCAGRNDCIIDKIR
RKNCPACRFRKCLQAGMNLEARKNKKLKRREQQSIRALEPAVPAMPVPVIPACMPQLVPA
MLSVLKAIEPEIIYSGYDGTLPDTSSRLMSTLNKLGGQQVISAVKWAKSLPGFRNLHLDD
QMTLLQCSWLFLMSFNLGWRSYKQCNGSMLCFAPDLIINQERMKLPYMTEQCEQMLKICM
EFVRLEVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMTYIKELGKAIVKREENTSQN
WQRFYQLTKLLDSMQGMVEDLLHICFYTFMNKTLSVEFPEMLAEIITNQIPKVKDGSVKQ
LLFHQK
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggaccagggcatcttgaagtgcaacagtaatcgagacgactccctgacattcatagag
ttgggaaccggagaatgcaaagaggcagctgacgccactggttccctgctctccgcgctc
caccccatttccccaaatgggggaggaaccaaagaccagctggagcccggaagcctcctc
gactcccaccagcagcgtcaggccctgttcgaagggtcgaacacaaatgatcagaaaatg
gtcagaatagagaaacggcagcaggatgtcggtgtgtttaacattgaggaggatttggca
ctgctgagccaaaatattgccgatctggacaacgtgtcctcgtctgtcatcaacacctcc
gtcctgggaaaccttcctcttcctgaccttttcccccagcacatcaaacaggaagtagac
ttctccctggataaagaattgggatcttacggaggacttccctccgcaacttcctgtgat
ttgacaggcggcactcgcctgattgaagacagtgagctttggaaagacctggaccttccg
ggatccctgccagagatcagcgactttgagctggattccgaagtggctcacttggataac
atcctgcacgacgacggcagacctgtcggaggcttgccaaaagccacgcaagtgcttacg
ggcaatggcgggaactgttatgctaatggcaccggccagcagcatcataacatgctccac
cctcctcatcagcagcatcaccttcttcagcaccaagttcagcaccaagttcacccccag
catcagcagcccgcatcccttctctcaagcgtcgtcatcaaagaagagaaccccgacaat
cctttcgcccacatccgtactcccagtatggtcaagcaggagaagcaggagcctgtgttc
tgccaggcacagtgtctccagggaggcatgggttcggttcatttaggagccccgatgtcc
tcgtcgatgagcgtggacgcggctggctatcgctgcagaaccaacgctccctccactatg
ggtcaacaaccccgggagccctttgccatgcactcaaacctgtcctcgttgggggagagc
tggatgcgaggggacgggtatggcgagtccaccgcgattcaaaggactaatgatgggctt
cccaacacgtcgatgttgatgtcatacccgctcagcttctccagctcaacacccagagca
ggagcagagtccaacagttctgtcgtgccgggtcaatcgaaacccaacgggcagacccac
aaagtgtgtttggtgtgttcggacgaagcctccggatgccactacggggtggtcacgtgc
ggcagctgcaaggttttcttcaagagggccgtggaaggatggagagcacgacaaaagagt
gatggccagcacaactacctgtgcgcaggaaggaatgactgcatcatcgataagatccgc
aggaaaaactgcccagcctgccgcttccgcaaatgccttcaagctggaatgaatttggaa
gcgaggaagaacaagaagctgaagaggagagagcagcagagcatccgagcgctggagccc
gccgtccccgccatgcccgtgccggtcatccccgcctgcatgccccagctggtgcccgcc
atgctgtcagtgctcaaggccatcgagcccgagatcatctactcgggctacgacggaacg
ctgcccgacacgtcgtcgcgcctgatgagcacgctcaacaagctcggagggcagcaggtc
atctcggccgtcaagtgggccaagtcgctgccaggcttccgtaacctgcacctggacgac
cagatgacgttgttgcagtgctcgtggctcttcctcatgtccttcaatctgggctggagg
tcgtacaagcagtgcaacgggagcatgctctgcttcgcccccgacctcatcatcaaccaa
gaacggatgaagcttccctacatgacggagcagtgcgagcagatgctgaagatctgcatg
gagtttgtgcgtctggaagtgtcctacgacgagtacctgtgcatgaaagtactgctgctt
ctcagcacagtgccaaaagacgggctgaagagtcaggcggtgttcgacgagatccgcatg
acgtacatcaaagagctgggaaaagccatcgtcaagcgagaggagaacaccagccagaac
tggcaacgcttctaccagctgactaagctactggactccatgcaggggatggtggaggat
ctcctccacatttgcttctacacattcatgaacaagacgctgagtgtggagttccccgag
atgctggcggagatcatcaccaaccagataccaaaagtcaaagacggcagcgtcaagcag
ctcctctttcatcagaagtga

DBGET integrated database retrieval system