KEGG   Hippocampus comes (tiger tail seahorse): 109518019Help
Entry
109518019         CDS       T04969                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109518019 (setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hcq03036]
    109518019 (setd2)
Enzymes [BR:hcq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109518019 (setd2)
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109518019 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 109518019
NCBI-ProteinID: XP_019729171
LinkDB All DBs
Position
Unknown
AA seq 2569 aa AA seqDB search
MEESLDLKHFLKDEGSGASVKVEGLSKAALIKSLSPRVMLSNHLLPKGTKMKVNLDDQSR
QKVSFSFSQTKKPLQSIFVIPSSPEKSDTEPHTASSQPTIDKGRASDSKNEQKQQPCAVP
ISAEPTSSQVPNFAAKLKMDLAKMHFKKQILSVSVTRENLTSVLRDETPTPNLQVLQKSP
SNIETKFSTLQHQNPVSVFPSEDIHCHSSERRTVSSLEKSAASSGKEEENSTTEQDTNVY
KRKTRSQTDRRTETDDPVPMSSRRKSVDSKSKTNLENSHKAVIKRSSPRSCGEEKEKSSS
KRSENHERSTSYTKSDRDSRYTSSRSLRSDKDRRRSRSRSRSRSKSRSSRTSSSHPRSER
SRGERGSRSDRSYYHDSDRRSYRGSPRRDRRRSRSRNDRTRDSSDSEDDHRKTRTRTSDS
SRSSTYSKSSSYLKSDKGSKSTDLPHSSELSKRSQTSSSTSERTTSKRLSDSDPQRKSSP
GVEARHYKTSSSHTLDTNRKSISSTQHTRVDSEKHEHENRLKSSASDTESDQRKKSLAGS
VLEEACIEEKMDRLDSKQNTCSRSSEETSEHDRQSKDIFHGPNDEPKHEATVKSCLLGEK
EKHGVNCIEKQSQDDHQDSQLTETHHNRLDGPKSSLEVEKEIAPAVSSNESMLHINATLE
KLNNMKDIFSPQNIPQVTSSATAVSLFASSDVIVHSVDMKDVESSQVSTPAPNAIDIAAA
PDAQICKPAEVVCNVIATEQAKKNAPLPSEQLFETENLKTLEQRADHAKQSSPTKKSRWD
IVGQNGPGSQESQHTLCAEQPKKVVCVKKIEFSKSQSQIEIIQSTHSIPEQETERPKQEN
SYNYGESSQGITGIDHNQKANFVQPLCNSDATRVNSVAKVGRWNGNVEEKSDKNAHTNES
NNTLASPEAGGGQSEASDSDNSEYDSDCDEAIKRLHSVVVVPKNSTVTSDSHDAGPSSCS
PVISESHITNDLANVSSHEVQYQVNYQQRLEGVSYHAGALCQSQSNMIDSTSHLEGSGAI
GVSQPYGTFPTNVHQGVTNFTHSLDGSGHYAQLQGQHYVNNSHEVMHAHYQHSASVDSIN
DCGGFTPSWSVSQPEQPSSTYQQPDSSHGPLLPQSKLSETFPSAQQHGHHGVSWNHQTSD
KQISKTPYLHLYQELAGEIHPDSLTNDHDDYCRAKPSIQSKATVDLSEPLGPSGFVQGHE
ISSNSKWSAVPDPPREDIFKTHRSRGPPKKRRPEIESDSDNEAEAGPAAKKERQGDVENA
KETQVKVDVLRPSLTLQHFQDSNRWKEFAKTKKMPPYFDLIEENLYLTERKKSKSHRDIK
RMQCECPVLPKQDRLRGILACGEDCLNRLLMIECSSRCLNGHYCSNRRFQMKQHADFEVI
LTEDKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKIRVKEYARNKNIHYYFMALKNNEII
DATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKAVSAGTELTFDYQFQRYGKEA
QKCFCGAPSCRGFLGGENRVSVRAAGGKMKKDRTRKNALTTVDEELEALLENGEGLYDGK
QVVSLCRLMVRVENMEQKLTCLKLIHDTQNPSCLKQFLDHHGLSLLWIFMVEISEAKGNC
ANNIKLQSEIMKTLAVLPISTKNMLEESKVLTFIQRWAQTKALPQPTEMDGYSSENTSRA
QTPLNTPDGSSSKLGPECDRDTSKPAVDRRLKIISENSLDSALSDASKASDGKEEEEEED
DEEEDESAQSVLPDDKQHKADTVNDASNPVRDSPDEEVKDTKVQKPEETEMASDRGEQIH
VEEVKDQIELEVKVDINVKPEMEFEVSDKPSGEELTIQAPIEMPEVEGDQPTVEIQDPEI
ESVQINIPQALTEQPAEQVVAKTETPEAENPPIGSEAQLDAPAPVAPSSSDTPEVSLPTE
DTPAPADTPAIETPSQDEEEGVSDVESERSQEPQVSALDISSMAARLLESWKDLKEVYRI
PKKSQVEKEANDRSRDRDTTLTPRNTSGSREREREREKDRDRDRDHDRDWERDRERDRDR
ERERDRDRERDRDKTPRSTERRRRRSTSPPPSYERSTRRTEERFDPSKTPRGVSGKERNK
LSTEERRKLFEQEVAQREAQKQQQQLQQQQQQQQQQQQQQQLQTMAYDPALAYASTSGFI
TYPPGYPLHTFVDPTNPNAGKVLLPTPTADPTMTYEQTTPQRLVSELGLPSPSSTSQATP
VSNISQHITTANHTPADTQQYAQPAVAAQDSSVSVLSVPAQTAPQIQGQQGYATLWDPAT
QQAVTVQTQPAQQYATAPAQGATQTAIYYQGQPCQTIYSIPTAYPQTSTPAIQAYSDPSA
SYLHGQTVYPGHQQGVVVQQGGTVTTIVTSQTVQQEMIVPNNVIDLPPPSPPKPKTIVLP
PNWKVARDPEGKIYYYHIGTRQTQWDPPTWDGSSDTNLDHDSEMDLGTPTYDENPSKFST
KTAEADTSSELAKKSKESFRKEMSQFIVQCLNPYRKPDCKHGRISNTEDFKHLARKLTHG
VMNKELKACTNPEDLDCNENVKHKTKEYIKKYMQRFGAVYRPKEDTEVY
NT seq 7710 nt NT seq  +upstreamnt  +downstreamnt
atggaagagtctcttgacctaaaacactttctaaaagacgaaggaagtggtgcctcggtc
aaggtcgagggcctttctaaggcagctctcatcaaaagtttgtctcctcgagtcatgctg
tccaaccatctcttgcctaaagggaccaagatgaaggtcaacctggatgatcagagtcgt
cagaaagtgtccttcagcttctcgcagaccaagaagccactgcagagcatttttgttatc
ccctcaagccccgaaaagtctgacactgaacctcacactgcctcatcacagcccacaatt
gacaaaggaagggcttctgacagtaaaaatgaacaaaagcagcagccttgtgcagtgcca
atttcagcggaaccgacatcttcccaagttccaaactttgctgctaagctgaaaatggac
ttggctaagatgcatttcaagaagcaaattctcagtgtgtctgttactagagaaaaccta
acatctgttcttcgggatgagacacccacccctaatttgcaggttttgcagaaatcgcca
agtaacattgaaaccaaattttcaactttgcagcatcagaaccctgtaagtgtcttccct
tctgaggatattcactgtcactcatctgagagacggacagtatcgagtctcgagaaatct
gctgcatcctcaggaaaagaagaggaaaattccacgactgaacaggatacaaatgtgtac
aaaaggaaaaccaggtcacaaaccgacagacgaacagagaccgacgatccagtcccgatg
tcttccagacgcaaatccgtcgactccaaaagtaaaacaaatttggaaaacagtcacaaa
gcagtaataaaaaggtcttcccctcggtcatgtggggaggaaaaggaaaaaagctcatca
aagcgatctgagaatcatgaaaggtcaactagttatacaaaatcggaccgtgattctagg
tacacctcgtcgcggtcactgcgatcagacaaagatcgtagaagatccagatcaaggtct
agatccaggtctaaatctagaagctctcgtaccagctcatctcacccaagatcagagaga
tcgaggggtgagagagggtcccgctcagacaggtcttactatcatgattccgatcgcaga
tcatacaggggttctccacgaagagacagacgacgatctcgttctcgcaacgacagaact
cgggacagctcggactctgaagatgaccatcgcaagacgaggacaaggacaagtgactct
agtcgatcatccacctattcaaagtcctcgtcctacttaaaatccgacaaaggatctaaa
tctacggatttgccacattcgtcagagttatctaaaagaagtcaaacctcatcttcgacg
tcagaaaggactacttcaaagcgactgtcagactccgacccccagcgcaaaagctctcca
ggtgtggaagccaggcattataaaactagcagcagtcatacattagacacgaacagaaaa
tccatctcatccactcaacatacccgtgtggatagtgaaaaacatgagcatgaaaatcgc
ctgaaaagcagcgcaagtgacaccgagtctgatcaaaggaaaaaatcactggcaggttcc
gttttagaggaagcttgtatagaagagaaaatggatcggcttgactctaaacagaacacc
tgctccagatcttccgaggaaaccagtgaacacgatagacaatcaaaagacatatttcat
ggccccaatgatgaaccaaaacacgaagctactgtaaaatcatgtttgctcggcgaaaag
gaaaaacacggtgtaaattgtattgaaaagcaaagtcaggatgaccaccaggatagccag
ttgacagagacgcatcataacaggttagatggaccaaaatcaagcctcgaagtggagaaa
gaaatagcaccggctgtcagctcaaatgagagcatgctgcacataaatgccacccttgaa
aagctaaacaatatgaaggatattttttctcctcaaaatataccacaagtgacttcaagt
gcaactgctgtaagtttattcgctagtagtgatgttatagtgcacagcgtggacatgaaa
gatgtcgaatcttctcaagtttcaacgcctgcgcctaatgcaattgatatagctgccgcg
cctgatgctcagatctgtaaaccggcggaagtggtatgtaatgtgattgccactgagcag
gctaaaaaaaacgcacctctaccatcagagcagttatttgaaactgagaatctgaagaca
cttgaacaaagggcggaccacgctaaacagagcagtccgactaaaaagtctcggtgggat
attgttgggcagaatggcccaggcagccaagagtcgcagcatacactttgcgccgaacaa
ccgaaaaaggtggtctgcgtgaaaaaaatagaattttccaaaagccaaagtcagatagaa
ataatacagagcacgcattccataccggagcaggagacggaaaggccaaagcaggaaaat
agttacaactatggcgaatcatcacagggtatcactggcattgaccataatcagaaagcg
aacttcgtgcagcctctgtgcaacagtgatgcaactcgggtcaacagtgttgcaaaagtg
gggagatggaatggcaacgttgaagagaaatctgacaaaaatgcccacacaaatgaatca
aataatacattagctagtccagaagctggcggaggacagagcgaggccagtgatagtgac
aattccgagtacgactctgattgtgatgaggcaataaaacgactgcactctgttgtggtt
gtgccaaagaattcgaccgtaacaagtgactcacatgacgctgggccttcttcgtgcagt
ccagttatttcagaatcccacattacaaatgatttggccaatgtgagtagtcatgaagtc
caatatcaagtcaactatcaacaaagactagaaggtgtttcgtaccacgctggtgctctt
tgccaatcccaaagtaatatgattgatagcacgagtcatttagagggttccggcgctatt
ggtgtttcacagccttatgggacctttccgaccaatgtccaccaaggtgtcactaatttc
acacacagccttgacggttctggacattacgcccaactgcaaggtcagcattatgttaac
aatagccatgaagtgatgcacgcacattaccaacattctgccagtgttgacagcatcaat
gactgcggcggattcaccccaagctggagcgtttcacagccagaacagcccagtagtaca
tatcaacagccggacagcagtcatgggccattgttaccccaatctaaactttcagaaaca
tttcctagcgcacagcagcatggacaccacggtgtctcttggaaccaccaaacctcagac
aagcagatcagcaaaactccctacctccatctttatcaggagcttgcaggtgaaatccac
ccagactcactcacgaatgaccatgacgattattgccgggctaagccgtccattcaaagc
aaagcgaccgtcgacctcagtgaaccactggggccgtcgggttttgtacaaggtcacgaa
ataagcagcaacagcaagtggtccgccgtgcctgacccaccgagggaggacatcttcaag
acccacagaagccggggccctcccaagaaaagacggccagagatcgaatcagattcggac
aacgaggctgaagctggacccgctgccaagaaggagcgccaaggagacgttgagaatgcg
aaagaaactcaagtcaaagttgatgtgcttcgcccatcactcactctgcagcactttcaa
gactccaatcgatggaaagagtttgccaagacaaagaagatgcccccatattttgacctg
attgaagagaatctatacctaacggaacgaaagaagagcaaatctcatcgggatatcaag
aggatgcagtgcgagtgcccagtgctgcctaaacaggaccggttaaggggaatattggcg
tgcggggaggactgtttaaataggctgctgatgattgaatgctcatcacggtgcctgaat
ggacactattgctcaaatcgacgctttcaaatgaagcagcacgccgactttgaagtcatc
ctcaccgaagacaagggctgggggctccgtgcagcaaaggacttgccttcaaataccttt
gtgctagaatactgcggggaagtgttggaccacaaagagttcaaaataagagtaaaagaa
tatgcacgtaacaagaacatccactactatttcatggctctaaagaataatgagatcatc
gatgcaacactgaagggtaattgctctcgctttatgaaccatagttgtgagcccaactgt
gagacccaaaagtggacagtcaatggccagcttagagtcgggttcttcaccaccaaggca
gtcagtgcaggaaccgaactgacatttgattaccagtttcagagatacgggaaagaagcc
cagaagtgcttctgtggagctcccagctgcagaggcttcctggggggggagaacagagtc
agtgtccgtgcagctggagggaagatgaagaaagaccggactcgaaagaacgctctcacc
acagttgatgaggaattggaggcgttactagagaatggcgaagggctctacgatgggaaa
caagtggtgtcactgtgcaggcttatggttcgcgtggaaaacatggaacagaaactcacc
tgtctcaagctcatacacgacacacagaatccatcatgtttgaagcagttcttagatcat
cacggcttgtctttgctttggatcttcatggttgagatttctgaagcaaagggcaactgc
gctaataacatcaagctacaatccgagattatgaagaccttggctgtgctacccatctcc
actaagaacatgctggaagagagtaaagtcctgaccttcattcagcgatgggcccaaaca
aaagcactccctcagcccactgagatggacggttactcaagtgagaacacttctcgtgct
cagacgcccctcaacacccccgatggttcctcctccaaattgggaccagaatgtgacagg
gacacctccaaaccagctgtggaccgccgccttaaaatcatcagtgaaaacagtctggac
agtgcgctctcagatgccagcaaagcatctgatggcaaggaggaggaagaggaagaagat
gatgaggaagaagacgagtctgctcagagtgtactacccgatgacaaacaacataaggca
gacacggtcaatgacgcctcgaatccagtgagagacagtccagacgaggaggtgaaagac
accaaagtgcagaaaccggaagagacagaaatggcttcagatagaggggaacaaattcat
gttgaagaggtaaaagaccaaattgagttggaggttaaagtggacatcaatgtcaaaccg
gagatggaatttgaggtctctgacaaacctagtggagaagagctgactatccaggcacca
atagaaatgcccgaagtagaaggtgaccagcctacagttgagattcaggacccagagatc
gagtcagttcaaatcaatattcctcaggctctaacggaacagcctgccgagcaggtggta
gccaagactgaaacaccggaggctgaaaatcctcctattggctcagaggcccaactggat
gcacctgcccctgttgctccctcaagttctgacaccccagaggtcagtctgcccactgaa
gacacaccagcacctgcagatacgccagccattgaaacgccttctcaggatgaagaggaa
ggtgtttccgacgtggagagtgagcggagtcaagagccccaagtcagcgctttggacatt
agcagcatggcagccaggcttttggaaagttggaaggatctcaaggaggtgtacagaata
ccaaagaagagtcaggtagaaaaggaagccaacgatcgcagccgagatcgcgacacaact
ttgactccacgcaacacctcaggtagtcgagagcgtgaaagggagcgtgaaaaggatcgc
gaccgggacagagaccatgaccgggattgggaaagggatagggagcgagacagggatcgg
gagagagaaagggaccgggacagggagcgtgatcgagacaaaaccccacgcagcactgag
agacggaggcgacgatccacatcaccacccccctcctatgagcggagcactcggcgcact
gaggaacggttcgacccgtcaaagacaccgaggggtgttagcggcaaggagcgcaacaag
ctgtctacagaggaacgcaggaagctgtttgagcaggaggtcgctcagcgggaagcccag
aaacagcaacaacagctgcagcagcaacaacagcagcagcagcagcagcaacagcagcaa
cagctccaaactatggcctatgaccctgccttggcctatgcctccacttctggcttcatc
acctacccacctggataccccctccatacatttgtggatcccaccaaccccaacgcaggc
aaagtactactacccacccctacagctgaccccaccatgacctatgaacagactactccc
caaagacttgtctcagagcttgggcttccctcgccatcatccacttcacaagccactcct
gtttctaatatctctcagcacatcaccaccgccaaccacacgcctgcagacacccagcag
tatgcccagcccgccgtcgcagcccaggattcgagcgtgtctgtcctctccgtgcccgcc
cagacggcgccccagatccagggccagcagggctacgccactctgtgggaccccgccacg
cagcaggcagtgactgtgcagacgcagccagcgcagcagtacgccacggccccggcgcag
ggcgccacacaaacggctatctactaccaaggccagccgtgccaaactatctacagcatc
cccaccgcataccctcagaccagcacgccagccatacaggcgtactccgacccctcagcc
agctatttgcacggccagacggtgtatcctggccatcagcagggcgtggtggtgcagcag
ggaggcacagtcaccaccatcgttacctcccaaactgtccagcaggaaatgatcgtaccc
aacaatgtgatagatctgcctcccccctctcccccgaaacccaaaactatcgttctacct
cccaactggaaagtggcacgggaccctgaagggaaaatctactattaccatattgggaca
aggcaaactcagtgggatcctccaacatgggacggaagtagcgacaccaatctggaccat
gactcagagatggacctgggcactcccacctatgatgaaaatccttccaagttctcaacc
aaaacagctgaagcagacacttcaagtgaattggccaaaaaaagtaaagagtcattccgc
aaagagatgtcccagtttattgtgcaatgtttaaatccttatcgaaaaccagactgcaaa
cacggccgcatcagcaacactgaagacttcaaacacctggcaagaaagctaacccacggc
gtcatgaacaaggaactcaaggcgtgcaccaacccggaggacctggactgcaacgagaac
gtcaagcacaagaccaaggaatacatcaagaagtacatgcagaggttcggcgccgtctac
aggcccaaggaggacacggaagtctactga

DBGET integrated database retrieval system