KEGG   Hippocampus comes (tiger tail seahorse): 109518172
Entry
109518172         CDS       T04969                                 

Gene name
steap3
Definition
(RefSeq) metalloreductase STEAP3
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    109518172 (steap3)
   04115 p53 signaling pathway
    109518172 (steap3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109518172 (steap3)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     109518172 (steap3)
Membrane trafficking [BR:hcq04131]
 Exocytosis
  Others
   Others
    109518172 (steap3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct 2-Hacid_dh_C NAD_binding_2 Shikimate_DH IlvN NAD_binding_10
Other DBs
NCBI-GeneID: 109518172
NCBI-ProteinID: XP_019729416
UniProt: A0A3Q2XUR0
LinkDB
Position
Unknown
AA seq 491 aa
MPEEMQQALIERGDDKGRCRPLEVCMSEFDTQVVGILGTGDFSRSLARRLVASGYRVVVG
SRTPKHAVALFPEEAEVTSQLEAASQADVVFVAIFPEHHATLLELKTALAGKILVDVSNS
SQIKRAGPSHAERLADMFPESFIVKGLNTISAWVLQTGSRDGSRQVFLCSDSSKAKSTVL
AMCRRMGFCPVDMGLLSSSREIENLPFYLFPSWGTPILITLILFIFFYLYNFVRDVVHPL
VKAKKSVFYKMPIETVNVTLPSVALVMLALVYMPGLLAALVQLRRGTKYDRFPNWLDKWL
TKRKQFGLCSFLCAAMHAIYSLCLPMRQSARFRLLNDAFKQVKEGVEDAWSDEGVWRMEL
YVSVGIIALGLLSLLAITSLPSVADNINWREFSFIQSTLGYCTLSMATVHTLLFGWDRAF
DPSQYRFLLPPTFMVVLILPVSVLLVRLILLLPCIAQQLRQIRRGWERSRHIRFILPNDD
RVTGFDNVSHV
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgcctgaggagatgcaacaagctttaatcgagagaggagacgataagggcaggtgcagg
ccgcttgaggtttgcatgtctgagttcgacacccaagttgtcggcatcctgggcactggc
gacttctcccgctcacttgccagaagactggtcgcctccggctaccgggtggtggtcggg
agtcgaacccccaaacacgctgttgcgctcttccctgaagaggcagaggtcacctcccag
ctggaggcagccagccaagcagatgtggtctttgtcgccatcttccctgagcaccacgcc
accctgttggagctgaagacggcgctggctggaaagatcctggtggatgttagcaacagc
tcgcagatcaagcgagccggaccatcccatgccgaacgactggctgacatgtttcctgag
agctttatagtgaaaggtttgaacacaatctcagcatgggtgcttcagaccggatctcga
gatggaagcaggcaggtgttcctgtgcagtgacagcagtaaggccaagagcacagtcctg
gcaatgtgtcgcaggatgggcttctgtcctgtggatatgggtctgctctcctcttctcgg
gagattgaaaatctccccttttatctgtttccttcctggggcacgcccatcctcatcaca
ttgattctcttcatcttcttctacctctacaactttgtccgtgatgtcgtgcatccactc
gtcaaagcgaagaagagcgtcttctacaaaatgcccattgaaactgtgaatgtcacttta
ccttccgtcgccttggtgatgcttgccctcgtctacatgccgggcttgcttgccgcgttg
gtccagttaaggcggggcaccaaatacgatcgctttcctaactggctcgacaagtggctc
accaagaggaagcagtttggattgtgcagcttcctgtgtgctgccatgcacgccatctac
agtctatgtctgcccatgaggcagtcagctcgcttcaggttgctcaacgatgctttcaaa
caggtgaaagagggtgtggaggacgcgtggagtgacgagggggtgtggagaatggagctg
tacgtctcagtgggcatcatcgcgctcgggctgctctccttgctggccatcacctcgctg
ccctccgtggctgacaacatcaactggcgagagttcagctttatacagtccactttgggc
tactgcaccctgtccatggccacggtgcatacactcctcttcggctgggaccgcgccttt
gacccgagccaataccgcttcctcttgccacccactttcatggtggtcctcatcctccct
gtctcagttctgttggtccgcctcattctcctgctgccctgtattgcgcaacagctccga
cagatccgccgcggatgggagaggagccggcacatccgcttcatcctgcccaacgacgac
cgtgtcaccggcttcgataatgtcagccatgtttga

DBGET integrated database retrieval system