KEGG   Hippocampus comes (tiger tail seahorse): 109518414Help
Entry
109518414         CDS       T04969                                 

Gene name
plod3
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
  KO
K13646  lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00310  Lysine degradation
hcq00514  Other types of O-glycan biosynthesis
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109518414 (plod3)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    109518414 (plod3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hcq01003]
    109518414 (plod3)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     109518414 (plod3)
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     109518414 (plod3)
    2.4.1.66  procollagen glucosyltransferase
     109518414 (plod3)
Glycosyltransferases [BR:hcq01003]
 O-Glycan biosynthesis
  O-linked Gal type
   109518414 (plod3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy Anp1 2OG-FeII_Oxy_3
Motif
Other DBs
NCBI-GeneID: 109518414
NCBI-ProteinID: XP_019729792
UniProt: A0A3Q2XS54
LinkDB All DBs
Position
Unknown
AA seq 771 aa AA seqDB search
MLSSRDFARLPSELRKERRVGEQFAMERKRLHRQVAAAMSSWLLGLLTLAVVLHASSGAQ
SRSISPENLLVITAATEETDGFVRFMRTAREFNYTVKVLGLGEEWKGGDVARTVGGGQKV
RWLKKELLKHSEHEEMVILFVDSYDVVFASGPEELLYKFSRLGHRVVFSAEGFCWPDQRL
APKYPPVHSGKRYLNSGGFIGFAPDINALVQQWKLKDDDDDQLFYTKIYLDRAQRTKFNM
TLDHRSRIFQNLNGAVDEVVLKFEKAKVRVRNVAYDTLPVVIHGNGPTKLQLNYLANYVP
TAWTYEEGCGNCDDDLIFFDEVDDQEMPLVHVAVFIHHATPFMEDFLERLTTLNYPLGRI
RLFIHNNVVYHERHIHEFWQRHRSFFPDAVLVGPEENLQEDRARKMAVEACLKNSHCDYY
FSIDSDVVLTNPDTLRILMEENKSVIAPILSKPGKLWSNFWGALSAEGYYSRSEDYIEIV
QGKRIGLWNVPYMSQAYLIKGSVLRSKLSKVNLYEDPNLDPDMAFCRRVREQGVFMFVSN
RDDFGRLVSSNNFNTSRLHPDMWQIFDNPLDWRAKYVHENYSKIFEDPKSFVEQPCPDVY
WFPAFSEKMCDDLVETMEDYGKWSGGKHTDERLAGGYENVPTVDIHMNQIGFEKEWLKFL
KEYIAPITEKLYPGYSPKAQAIMNFVVRYRPDEQPSLRPHHDSSTFTINIALNSKNVDYQ
GGGCRFLRYDCNVESPRKGWSFMHPGRLTHYHEGLPTTSGTRYIMVSFVDP
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcctcgcgagatttcgccaggcttccgtccgagctgcgaaaggagcggagagta
ggggagcaatttgcgatggaacggaagcgtttacatcgacaagtggccgctgccatgtct
tcttggctcctcggcttgctaacactcgctgtcgtgctccacgcttcctccggggctcaa
tcgcgcagcatctcgccagagaatcttctggttatcacggctgccacggaagagacagac
ggctttgtgcgcttcatgaggacagccagagagttcaactacacagtgaaggttctgggc
ctgggagaggaatggaaaggtggcgacgttgctcgtacggtgggcggcgggcagaaggtg
cgctggctgaagaaggagctgctcaaacactcagagcacgaggagatggtgatcttgttt
gtagacagctacgatgtagtattcgcgtcgggtcctgaggaactcctgtacaaattctca
cgactgggccaccgtgtggtgttctccgccgagggcttctgttggccggaccagaggctg
gctcccaagtaccctcccgtgcattcggggaaacgctacctcaactcgggagggttcatt
ggcttcgcaccagatatcaacgccctcgtccagcagtggaagttgaaagacgacgacgat
gaccaacttttctacaccaaaatctacttggaccgggcacagcggaccaaattcaacatg
acgctggaccaccgctccaggatcttccagaacctcaacggtgccgttgatgaagtcgtc
ctcaagttcgagaaggccaaggtccgcgtgaggaacgtcgcctatgacacacttcctgtt
gttattcacggcaacggacccactaagctgcaactcaactatttggccaactacgtcccg
acagcgtggacatacgaggagggatgcggcaactgtgatgatgatttaattttcttcgac
gaagtagatgaccaggaaatgccgctggtgcacgtggctgtgttcatccaccatgctacg
cccttcatggaggacttcctggagcggctgaccacactcaattacccgctagggcgcatc
cgtctcttcatccacaacaatgtggtgtaccacgagcgccacattcatgagttctggcag
cgccaccgttcttttttccccgacgccgtgctggtcggacccgaggagaacctgcaggag
gaccgggctcgcaagatggctgtggaggcgtgtctgaagaattcccattgcgattactac
ttcagcatcgactcggatgttgtcttgaccaaccccgacaccttgaggattctcatggag
gagaacaagtccgtcattgcgcccatactatccaaacccgggaagctgtggagcaacttc
tggggcgccctgagcgccgaaggctactactccagatcggaagactacatcgagattgtt
caagggaagaggatcggcctgtggaacgttccgtacatgtctcaggcctacttgatcaaa
ggcagcgtgctgcgctccaaactgtccaaggtcaacctgtacgaggaccccaacttggac
ccagacatggcgttctgtcggcgggtccgagaacagggagtgttcatgttcgtgtccaac
cgcgacgactttggccgtctggtgtcgtccaacaacttcaacacgtccaggctgcacccg
gacatgtggcagatctttgacaaccctctggactggagggccaagtacgtccatgagaac
tactccaagatctttgaggaccctaagagctttgtggagcagccgtgtccggatgtatac
tggttcccggccttttcggagaagatgtgtgacgacctagtggagaccatggaagactat
gggaaatggtccggcggcaagcacacggacgaacgtctggctggcggctacgaaaacgtt
cccactgtggacatccacatgaatcagatcggatttgagaaggaatggctcaagtttctt
aaagagtacattgcgcccatcacggaaaaactctatcccgggtactcgcctaaggctcag
gccatcatgaatttcgtggtgcgctaccgtcccgacgagcagccgtctttgcgaccgcat
cacgactcgtccacgttcaccatcaacatcgccctcaacagcaaaaacgttgactaccag
ggcggaggttgccggttcctgcgttatgactgcaacgtggagtcgcccaggaagggctgg
tccttcatgcaccccggccgcctgactcactaccacgagggtctgccgacgaccagcgga
accaggtacatcatggtgtcctttgtggacccctaa

DBGET integrated database retrieval system