KEGG   Hippocampus comes (tiger tail seahorse): 109518922Help
Entry
109518922         CDS       T04969                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type-like isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00010  Glycolysis / Gluconeogenesis
hcq00030  Pentose phosphate pathway
hcq00051  Fructose and mannose metabolism
hcq00052  Galactose metabolism
hcq01100  Metabolic pathways
hcq01200  Carbon metabolism
hcq01230  Biosynthesis of amino acids
hcq03018  RNA degradation
Module
hcq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109518922
   00030 Pentose phosphate pathway
    109518922
   00051 Fructose and mannose metabolism
    109518922
   00052 Galactose metabolism
    109518922
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    109518922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hcq01009]
    109518922
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hcq03019]
    109518922
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     109518922
Protein phosphatases and associated proteins [BR:hcq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109518922
Messenger RNA biogenesis [BR:hcq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     109518922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 109518922
NCBI-ProteinID: XP_019730659
LinkDB All DBs
Position
Unknown
AA seq 792 aa AA seqDB search
MSAPKRQDTRKLFENLSGHGKSIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGY
QGMVDGGDNIKEASWESVSSMLQVGGTVIGSARCKAFRTREGRLQAALNLVQKSITNLCV
IGGDGSLTGANLFREEWSGLLDELLQKGAISEEAARSNSALHIVGMVGSIDNDFCGTDMT
IGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFFPEMPP
EDGWEENMCQKLSENRADKKRLNIIIVAEGAIDCHNKPITPDYIKDLVVRNLGFDTRVTI
LGHVQRGGTPSAFDRILASRMGVEAVLALLEASPGTPACVVSLVGNQAVRLPLMECVQMT
QEVHKAMDEKKFEDAVRLRGRSFENNLSTYRLLCNRKADSELPHVSISFNVAVLNVGAPA
AGMNAAVRSAVRVGITEGHKMFAVSDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKRT
LPGKHLEQIAQQMALHNINALLVIGGFEALESVLQLYEAREHFEEFCVPLCMLPATISNN
VPGTDLSIGADTSLNALVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADT
VYIYEEPIDIRDLQGNVEHLTEKMKTTIQRGLVLRNENCNENFTTDFIYQLYSEEGRGVF
DCRKNILGHMQQGGAPSPFDRNFGTKVAAKAVQWLTKTMKESYKGGRVFANSEDSACLLG
MRRRAMVFQPVAQLKQETDFEHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVGR
FRAKEGDPSTAI
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccccaagcgacaagacacccgcaaactctttgagaacttgtccggccatgga
aagtccatcgcggtgcttaccagtggcggagatgcccaagggatgaatgcagcggtccgg
gctgtggtccgcatgggaatttacgtgggagccaaagtctactttatacatgagggttac
cagggcatggtggatggcggcgataacatcaaggaggcgtcatgggaaagtgtctccagc
atgttgcaagtgggcggcacggtgatcggcagcgctcgctgcaaagccttccgcacccgc
gagggccgcctgcaggcggccctcaacttggtgcagaagagcatcaccaacctttgtgtc
attggtggtgacggaagcctgaccggggccaatctcttccgggaggagtggagcggtctt
ctggacgagctactgcagaagggagcaatcagcgaggaggcggcgcgcagcaactcggcc
ctgcacatcgtgggcatggtaggctccatcgacaatgacttctgcggcaccgacatgacc
atcggaactgactcggcgctgcaccgcatcatcgaggtggtggacgccattatgaccact
gctcagagccaccagaggacattcgtgctggaggtgatgggtcgccactgcggatacttg
gcattggtcagcgctctggcctgcggggcagactgggtgttttttcctgaaatgcctcct
gaagacggctgggaggaaaacatgtgccagaagctgtctgagaaccgtgctgacaaaaag
agactcaacatcatcatcgtggctgaaggagccatcgactgccacaacaaacccatcacg
cccgactacatcaaagacctggtggtgcgcaacctgggcttcgataccagggtgacaatc
ctgggccacgtgcagcggggaggaaccccatccgccttcgacaggatcctggccagtcgt
atgggcgtggaggcggtgctggccttgctggaggcctctcccggcacaccagcctgcgtg
gtgtcgcttgtgggcaaccaggccgtgcgcttgcccctcatggagtgcgtgcagatgaca
caggaagtgcacaaggctatggacgaaaagaagtttgaggatgcagtcagactgcgtggc
aggagctttgagaacaacctgagcacctaccgacttctctgcaaccgcaaggctgactcg
gagcttccacatgtaagcatctccttcaacgtggccgtgttgaacgtcggggcgcccgcc
gccgggatgaacgccgccgtgcgctctgccgtccgggtgggcattaccgaaggccacaaa
atgtttgcggtgagcgacggcttcgagggattctacaagggtcagatcaaggagatcaag
tggggcgacgtcggaggctggacgggacaaggaggctcgctgctcggcaccaaaagaaca
cttcccgggaaacatctggagcagatcgcccaacagatggcgctccacaacatcaacgcg
ttgctcgtcatcggcggatttgaggccctggagtccgtcctgcagctgtatgaggctcgc
gagcactttgaggagttttgcgtgccgctgtgcatgctgcccgccaccattagcaacaac
gtgcccggcaccgacctcagcatcggcgccgacacctccctcaacgcccttgtggagaca
tgcgaccgcattaagcagtcggccagcggtaccaagcggagggtcttcatcatcgagact
atggggggctactgcggttacttggccactgtgggcgggctggcggcgggcgctgacacc
gtctacatctacgaggaacccattgacatccgagacctgcagggtaacgtggaacatctg
acggaaaagatgaagaccaccatccagagaggtctggtgcttaggaacgagaactgcaat
gaaaacttcaccactgacttcatctaccagctttactctgaggaaggtcgaggagtgttt
gactgcaggaagaatattttggggcacatgcagcagggtggcgctccgtctccatttgac
agaaactttggcaccaaagtggcggctaaagcagtccagtggctcaccaagaccatgaag
gagtcttacaaaggaggccgagtattcgccaactccgaggacagcgcctgtctgctgggc
atgagacgccgtgcgatggtcttccagcctgtggcgcagctcaaacaggagaccgacttt
gaacaccggatccccaaggagcagtggtggctgaagctccgccccctgatgaagatcctg
gccaaatacaagacgagttacgacgtgtccgactcgggtcagttggagcacgttggccgc
ttccgggccaaagagggcgacccctcaactgccatctga

DBGET integrated database retrieval system