KEGG   Hippocampus comes (tiger tail seahorse): 109519080Help
Entry
109519080         CDS       T04969                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00590  Arachidonic acid metabolism
hcq01100  Metabolic pathways
hcq04370  VEGF signaling pathway
hcq04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109519080 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109519080 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109519080 (ptgs2)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109519080 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 109519080
NCBI-ProteinID: XP_019730958
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MNKSTLTLLLLFLGCLVCEGGNLCCSEPCQNRGVCTALGSDAYECDCTRTGYYGPNCTTP
EFLTRIKVLLKPTPNTVHYLLTHFKGFWNIINNISFLRNAIMKYVLTSRSHMIDSPPTYN
ADYHYKSWEAYSNLSYYTRALPPVQQDCPTPMGVVGKKELPDVKLLAEKLLMRRKFIPDP
QGTSLMFAFFAQHFTHQFFKSDMKRGPAFTVAKGHGVDLSHVYGDSLEKQHKLRLFKDGK
LRYQMLDGEMYPPTVKDVGVDMHYPPHVPHSHRFAVGHEAFGLVPGLMMYATIWLREHNR
VCNVLKQVHPYWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFSQRF
QYQNRIASEFNTLYHWHPLMPDSFHIEEKNYNYKEFVFNTSVVTEHGIASLVESFSKQIA
GRVAGGRNVPGPIMYVAIKSIEASRQMRYQPLNAYRKRFSMAPYKSFEDLTGEKEMAAVL
EEMYGDIDAVELYPGLLVEKPRPNAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFG
GSVGFDIVNTASLQKLVCNNVQGPCPVASFHVPDIDDTGSTVINSSTSPSRSGDMNPTVI
LKKRTSEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagtccactttaacgcttctcctcttgtttcttggttgtcttgtttgtgaggga
ggtaacctttgctgctcagagccatgccagaacagaggtgtttgcacagccctcggatct
gacgcttatgaatgtgactgcacgcgtactggctattacggcccaaactgcacaacacct
gaatttctcacccggataaaagtgctcttgaagcccacacccaacacagtccactatctt
ctcacccacttcaagggcttctggaacatcatcaacaacatctcgtttctcagaaatgcc
atcatgaaatatgtgctaacatctcgctcccacatgattgacagccccccaacctacaat
gcagattatcattacaaaagctgggaagcatattccaacctttcctactacacgagagcc
ctccctccagtgcaacaggattgcccaacaccgatgggagtcgtaggtaaaaaggagctt
cctgatgtgaagctgcttgcagagaagctactgatgaggaggaaattcatccctgaccca
cagggcaccagccttatgtttgcattttttgcacagcactttacacaccagttctttaaa
tcggacatgaaaagaggtcctgccttcacagtggcaaaagggcatggggtggacctcagt
cacgtttatggagacagcctggagaagcaacacaaactgaggctcttcaaagacggcaaa
cttagatatcagatgctggatggggagatgtaccctccgacagtaaaagatgtaggcgtt
gatatgcactacccccctcacgtccctcactctcatcgctttgctgtgggccatgaggct
tttggcctggtccctggtctcatgatgtatgccaccatttggctccgggaacacaatcga
gtgtgcaatgtcttgaagcaagtccatccttattgggatgacgaaagactctttcagact
tcgcgactcattctgattggggaaaccatcaagattgtgattgaggactacgtccagcac
ctgagtggctataacttcaagctaaaatttgatcctgagctgctcttcagccagcgtttc
cagtaccagaaccgcattgcatctgagttcaacaccttataccactggcacccactgatg
cccgactccttccacatcgaggagaaaaactacaactacaaagagtttgtcttcaacacc
tctgtagtgactgagcacggcattgccagcctggtggagtccttcagcaagcagatagct
gggcgggttgctggtggtcggaatgtcccaggaccgattatgtatgtggctattaagtcc
atagaggccagcagacaaatgcgttaccagcctttgaacgcctacaggaaaaggttctct
atggctccgtacaagtcttttgaagatttgacaggtgaaaaagaaatggcagcagtgctt
gaagagatgtatggagatattgatgccgtagagctctacccaggcctacttgtggaaaaa
cccagacccaatgccatctttggggagaccatggtggagatgggagcccctttctcactc
aaaggcttgatgggaaaccccatctgctctccagaatactggaagcccagcacgtttgga
ggcagtgtaggatttgacattgtcaatacagcatctctgcagaagcttgtgtgcaataat
gtgcaggggccttgtccagtggcatcatttcacgtgcctgacatcgatgatacaggctcc
accgtcatcaactccagcacatccccctcacgcagtggtgacatgaacccgacagtcatt
ttgaaaaaaaggactagtgagctctaa

DBGET integrated database retrieval system