KEGG   Hippocampus comes (tiger tail seahorse): 109519449
Entry
109519449         CDS       T04969                                 

Gene name
ddb2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq03420  Nucleotide excision repair
hcq04115  p53 signaling pathway
hcq04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109519449 (ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    109519449 (ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109519449 (ddb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hcq04121]
    109519449 (ddb2)
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109519449 (ddb2)
Ubiquitin system [BR:hcq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     109519449 (ddb2)
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      109519449 (ddb2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 109519449
NCBI-ProteinID: XP_019731547
UniProt: A0A3Q2Y5P2
LinkDB
Position
Unknown
AA seq 489 aa
MKSKPSKSDSFESKKVKVKKGAGGEMSGATLSAKPQDKKDAKACKKGSPLKSSGIQKKSG
HSILHYIYKHTLGQSVHTQMKQCLQEPFIRSLTLYHYHASNHPFDRRVTCLEWHPTNPTT
LALGSKGGDIELWDFKLRDRKMFIRGNGAGDFIGGMKFCPTDLSRVYVASGEGTLTMQSF
EGLTTTIIAKTEDCGHHHHNVCFWYCCVDVSISRQMLATGDNVGNCLLVGLDGQKIFSEK
LHKAKVTHAEFNPRCDWLLVTASVDHTVKLWDLRNMKDKNSFLYDMPHEKAVNSAYFHPS
DCSKLVTTDQYDQIRVYSSSDWSKPQHIIQHPHRHFQHITPIKATWHPVYDLIVVGRYPD
DKICLGDQRTIDIFDSNTAELVCQLHDPNVAGIKCINKFNPMGDVIGSGMGVSVVLWDQD
ESLLGDEHTPQEEVPTSAERPQRERGRQQQATRSRRSGADQSKLKKKLLSAHESETTTKT
KCAKRTRKL
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgaaaagcaaaccctccaaatcagatagcttcgagtccaaaaaggttaaggtgaagaaa
ggcgctggcggggagatgtctggtgcaactttgtccgcaaaaccgcaggacaagaaagat
gcaaaggcatgcaaaaaagggtctcctctcaagtcctcaggaatccagaagaaaagtgga
catagcatactccactacatctacaagcacactctgggccaaagtgttcatactcaaatg
aaacagtgcctccaagagccttttatccgctcgctcactttgtaccattatcacgcgtca
aaccatcccttcgaccggcgagtcacctgcctggagtggcatcccactaatcccaccaca
ctggcgttgggatcgaaaggtggcgacatcgagctgtgggactttaagctccgtgaccgg
aagatgttcatcagagggaatggcgccggagacttcatcggagggatgaaattttgcccc
acggatctgtcccgagtgtacgtggcctctggtgagggcacactgaccatgcagagcttt
gagggcctcacaaccaccattatagccaaaacggaagattgtggccaccatcaccacaac
gtatgtttctggtactgctgtgttgacgtgtccattagccgacagatgcttgcgactgga
gacaatgttggaaattgcctcctggtgggtctagatgggcagaagattttcagtgagaag
ttacacaaagccaaagtgactcacgctgagttcaacccacgctgcgattggctgcttgtg
acggcgtcagtagaccacacagtgaagctctgggacctgagaaacatgaaggacaagaac
agcttcctttatgacatgcctcacgagaaagccgtcaactcagcctattttcatccctcg
gactgctccaaattggtaacaactgatcagtacgaccagatccgtgtgtattcatcctct
gattggtcgaagcctcagcatatcatccaacatccacacagacattttcaacatatcaca
cccatcaaggctacatggcatcctgtgtatgaccttattgtggtgggtcgttaccccgac
gacaagatttgcctgggcgaccagagaaccatcgacatctttgattccaacacagccgag
cttgtgtgtcagttgcacgatcccaatgttgcgggaatcaaatgtatcaataaattcaat
ccaatgggagatgtgattggctctggaatgggtgtatcggtggtactttgggaccaggat
gagtcattgttaggtgatgaacacacgccgcaggaggaagtgcctacctcggctgagcga
ccacaaagggaacgcggtcgtcagcaacaggccacccggagcaggagaagcggcgcggat
caaagtaaactcaagaaaaaactgctgtctgcgcacgaatcagaaacgacgaccaagact
aagtgcgcaaagcgcacaagaaagctgtga

DBGET integrated database retrieval system