KEGG   Hippocampus comes (tiger tail seahorse): 109519470
Entry
109519470         CDS       T04969                                 

Definition
(RefSeq) protein reprimo A-like
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109519470
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 109519470
NCBI-ProteinID: XP_019731590
UniProt: A0A3Q2XCE7
LinkDB
Position
Unknown
AA seq 102 aa
MNATGFNHTEGSLFNRTEGMLCCNLSSVVTDEGLAAASPDERSLFVMRVVQIAVMCVLSL
TVVFGIFFLGCNLLIKSEGMINFLVTDRRPSKEAEAVIVGAY
NT seq 309 nt   +upstreamnt  +downstreamnt
atgaacgccaccggcttcaaccatacggagggcagcttgttcaacaggacagagggcatg
ctgtgctgcaacctgtcgtcggtggtgaccgacgaaggcttggcggccgcctccccggac
gagaggagcctgttcgtcatgcgggtggttcagatcgccgtcatgtgcgtgctgtccctc
accgtggtcttcggcatcttcttcctgggctgcaacctgctcatcaagtccgagggcatg
atcaacttcttggtgactgacaggaggccgtccaaagaggccgaggccgtcattgttgga
gcctactga

DBGET integrated database retrieval system