KEGG   Hippocampus comes (tiger tail seahorse): 109520052
Entry
109520052         CDS       T04969                                 

Definition
(RefSeq) uncharacterized protein LOC109520052 isoform X1
  KO
K05461  KIT ligand
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109520052
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109520052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hcq04052]
    109520052
Cytokines and growth factors [BR:hcq04052]
 Growth factors
  Growth factors (RTK binding)
   109520052
SSDB
Motif
Pfam: SCF DUF4307
Other DBs
NCBI-GeneID: 109520052
NCBI-ProteinID: XP_019732569
LinkDB
Position
Unknown
AA seq 254 aa
MREKIFKAPCLLLSLLTSWNLCCGKLGPPITDDVSKLSLLKHNIPSDYEIPVYYIPKEVS
GECWVVLNVYPLEQSLRNLADMFGAVSSNRENILVFVTMLKSLRFTFDNQELETAMQVFQ
CHYKEGSLKNELYFDYIEEILNAAGHEASSFSCKPPPCLNTANGPGGQKGGRDYRWWKRT
PLLLVIVPVAACVVLIVWRVTSTRHSPERTAEEIEMSPADSVLSVSVSVPLQKPDGVACD
ALAEEDPLAGHDSR
NT seq 765 nt   +upstreamnt  +downstreamnt
atgagggagaaaatcttcaaggcaccttgtctcctcttgagtctgttgacaagttggaat
ctgtgctgtggaaaactcggacccccaataactgatgatgtgagcaagctgtcgctgctg
aagcacaacatcccttccgattatgagattcctgtttattacattcccaaagaagtgtct
ggtgagtgttgggtggtattaaacgtctacccattggagcaaagtcttcgcaacctggcc
gacatgtttggcgccgtctcctccaacagggaaaacatcctggtcttcgtcaccatgctg
aagagcctgcgcttcacgtttgacaaccaggaattggaaacggccatgcaagtctttcag
tgtcactacaaggaggggagcttgaagaatgagctctatttcgactacatcgaggagatc
ctcaacgccgcaggtcatgaagcatccagtttctcctgcaagccgccgccttgtctcaat
acggcaaacggaccagggggtcaaaagggaggtcgcgattacagatggtggaaaagaacg
ccgctgctgctggtgatcgttccggtcgcggcttgcgtcgttctcatcgtatggcgggtc
acatcaacgagacattcgccggagcgcaccgccgaggagatcgaaatgtcacccgccgac
tccgtcctcagcgtgtccgtttccgtcccgcttcaaaagcccgacggcgtcgcctgcgat
gctctcgcggaggaggacccgcttgccggtcatgacagcaggtga

DBGET integrated database retrieval system