KEGG   Hippocampus comes (tiger tail seahorse): 109520063
Entry
109520063         CDS       T04969                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04020  Calcium signaling pathway
hcq04260  Cardiac muscle contraction
hcq04261  Adrenergic signaling in cardiomyocytes
hcq04270  Vascular smooth muscle contraction
hcq04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109520063
   04020 Calcium signaling pathway
    109520063
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109520063
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109520063
   04261 Adrenergic signaling in cardiomyocytes
    109520063
   04270 Vascular smooth muscle contraction
    109520063
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hcq04040]
    109520063
Ion channels [BR:hcq04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109520063
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 109520063
NCBI-ProteinID: XP_019732578
LinkDB
Position
Unknown
AA seq 2113 aa
MTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYL
RNGWNLLDFIIVVVGLFSAILEQATKGDGAAPMGGKAAGFDVKALRAFRVLRPLRLVSGV
PSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYHEHAGTLAEEKP
APCAPDLAYGRHCNHNGTECKMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWM
QDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEE
DLKGYLDWITQAEDIDPENEEEGLDDDKPRNLSMPASENESVNTDNAPGGDVEGETCCTR
LANRISKSKFSRYSRRWNRLCRRKCRAAVKSQLFYWLVIFLVFLNTLTIASEHHQQPQWL
TDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMS
PLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQL
FGGKFNFEETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFI
ILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARLGTPDKRHNNEKPP
LEEEKREKIELKSITSDGESNTATKINMDDYCGDESEEKNPYPANDYIGDEDDEEPDVPV
GPRPRPLSDIQLKEKAVPMPKARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSI
SLAAEDPVKNDSFRNEILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLV
VVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIV
TTLLQFMFACIGVQLFKGKFFFCTDNSKQTKAECRGNYIKYKDGDVAKPERALRQWENSE
FNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHTEDVGPIYNYRVVISIFFIIYIIIIAF
FMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYV
VNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKP
RGYFSDPWNVFDFLIVIGSIIDVILSEINPADSSSSSSSSSSSSSSSSSHPPVVRPMGLQ
NSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYA
VIGMQMFGKIALRDHTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSLYRPCEKGS
TNENVAIQEDCGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDE
FKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTV
MFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVG
KFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHDIGPEIRRAISGDLTVE
EEVDKGPKEPVSAASEDDIFRVKRSGGLFGNHVNYYNQSDGRASFPQSFTTQRPLHISQK
GSPCEGDSPSHEKLMDSTTFTPSSYSSSGSNANINNANNTGMVGVAPQGGGRFPGSSVST
VDGHAGQPLTPVLLPRSAWCFPPKRTCFFDNLLRSDSSDSRLPIIRRGEGSTEETYDESY
ADEREFQEDDHSLSSDMLVYRDDTCKQLTPMEEGDDMEERRGVGGWQSPRRVFLCPTSLG
RRSSFHLECLRRQSRADVSQKTAVPLHLVHHQALAVAGLSPLIRRSHSPTLFSRLCSTPP
ASPAEQGSDASYQRVPSLRLEGSNSHEKLNASLPSVNCGPWYTDSNGNSRVPSPSPASGM
PTTNQRAARPVSLTVPSLLGHDSSSSHGSAGSLVEAVLISEGLGQFAQDPSFIEATKAEL
ADACDMTIEEMEHAASNILNGNAPASDATAPVASQHSPNGNFHRDRDRGAEDGGEAGGNR
GSVHGPSSVEERQELLAGARGQEEEDDDEEEEEEEEVGGREEGHHRSSAAMAGARQRTSG
LLEDEDMECVTSL
NT seq 6342 nt   +upstreamnt  +downstreamnt
atgaccattttcgctaactgtgtggccttagccgtctacatccccttcccagaggacgac
tccaacgccaccaactccaatctggagcgcgtggagtatttattcctcatcatcttcacc
gtggaggcgttcctgaaggtgatagcctacggcctgctcttccaccccaatgcctacctg
aggaacggctggaatctgctcgacttcatcattgtcgtcgtcgggttgttcagtgccatc
ttggagcaggccaccaagggtgacggggccgcgccgatgggaggcaaggctgccggtttt
gacgtcaaggctctgagggcattccgagtactccgacccctccgactggtttcaggagta
cccagtttacaggtcgtgttgaattccatcatcaaagccatggtccccctgctccacatc
gccctcctggtcctcttcgtcatcatcatctacgccatcatcggcctggagctcttcatg
ggcaagatgcacaagacctgctatcacgagcacgcaggcacgctggcggaggaaaaaccg
gcgccgtgcgcgcccgacttggcgtacgggcgacactgtaaccacaacgggaccgagtgc
aaaatgggctgggagggccccaacgacggcatcaccaactttgacaactttgccttcgcc
atgttgaccgtgttccagtgcatcaccatggagggctggacggacgtgctgtactggatg
caggatgctatgggctatgagctgccatgggtctattttgtctctctcgtcatcttcggc
tcctttttcgtcctcaatctcgttctgggggtgttgagtggagagttttccaaggagagg
gagaaggccaaggcacggggtgacttccagaaactccgagaaaaacagcagctggaggag
gatctcaagggctacctcgattggatcactcaggctgaagacatcgacccggagaatgaa
gaggagggtctggatgacgataaacccagaaacttgagcatgccggccagcgagaatgaa
tcggtcaacacggacaacgcgcccggaggtgatgtggagggagagacctgctgcacccgg
ctagcaaataggatctccaaatccaagttcagtcgctactctcgcaggtggaacaggctg
tgcaggcgcaagtgtcgggcggccgtcaaatcgcagcttttctattggctggtcatcttc
ctggttttcctcaacactctcaccatcgcctcggaacatcaccagcagccgcagtggtta
acggacgtacaagacatagccaacaaggtgttgctcgcactcttcaccggtgagatgctc
ttgaagatgtacagcctgggccttcaggcgtacttcgtctcgctcttcaaccgcttcgac
agctttgtggtctgcggcgggattctggagaccatcctggtggaaaccaagatcatgtcg
ccgctcggcatctccgtgctgcgttgtgtacgcttgctgcgaatcttcaaaataaccaga
tactggaactcgctgtccaatttggtggcctccttgctgaactccgtgcgctccatcgcc
tccctgctgcttctgctcttcctcttcatcatcattttctccctgctgggcatgcagctc
tttggcggcaagttcaacttcgaggagacccggcggagcacctttgacaacttcccccag
tcgctgctgaccgtcttccagattttaactggtgaggactggaactcggtgatgtatgac
gggatcatggcgtacggtggcccctccttccccggcatgctggtttgcatctacttcatc
atcctcttcatctgcggaaactatatccttctgaacgtcttcttggccatcgctgtggac
aatctggccgacgcggagagcctgacatctgcccagaaagaggaagaggaggagaaggag
aggaagaaactggccaggctgggcacgcctgacaagaggcacaacaacgagaagcctcca
ctggaggaggagaagagagagaagattgagctgaagtccatcacttcggacggcgagagc
aacacggccacgaagataaatatggacgattactgcggcgatgagagcgaagagaaaaat
ccataccctgcaaacgattacatcggcgatgaagacgacgaggaacccgacgtgccggtg
ggcccgcggccgcggccgctctccgacatccagctcaaggagaaggccgttcccatgccc
aaagctcgcgctttcttcgtcttcagccacaccaacaaattcagggttctgtgccataaa
atcgtcaaccacaacatcttcaccaacctcatcctcttcttcatcctgctcagcagcatc
agtctggcggcggaggacccggtgaagaacgactccttcagaaatgagatcctgggctat
gcagaccacgtcttcacggggcttttcaccatcgagattattctcaagatgacagcttac
ggagccttcctccacaaaggctctttctgcaggaactatttcaacattctggacctggtg
gtggtcagcgtttccctcatttcctctgggatacagtccagtgcgatcaacgtggtgaag
atcctgcgagttctccgagtgctccgacctctgcgggccatcaacagagccaaaggcctg
aagcacgtggtgcagtgcgtgtttgtggccatcaggaccatcggcaacatcgtcatcgtc
accacgttgctccagttcatgttcgcctgcatcggggtgcagcttttcaagggcaagttc
ttcttctgcaccgacaactcgaaacagacgaaggccgagtgcagaggcaactacatcaag
tacaaggacggcgacgtggccaagcccgaacgagccctgagacagtgggagaacagcgag
tttaactttgacgatgtgctccaaggcatgatggctctgtttgcggtgtccacttttgag
ggctggccggggctcctctaccgggccatcgactctcacaccgaggacgtgggtcccatc
tacaactaccgcgtggtcatctccatcttcttcatcatctacataatcatcatcgccttc
ttcatgatgaacatcttcgtgggtttcgtcatcgtcaccttccaggagcaaggcgagcag
gagtataagaattgcgagctggacaagaaccagcgtcagtgtgtcgagtatgccctgaag
gcccgcccccttcgccggtacatccccaagaacccgtaccagtacaaggtgtggtacgtg
gtcaactccacctactttgagtacctgatgttcacgctcatccttctcaacaccatctgc
ctggccatgcagcaccacggtcagacgaagaacttcaacgacgccatgaacatcctcaac
atgctcttcacggggctcttcaccgtggagatgatcctcaagttgatcgccttcaaaccc
agggggtactttagtgatccctggaatgtgtttgatttcctcatcgtaattggcagcata
atagacgtcattctcagtgaaatcaacccagctgactcctcctcgtcctcctcctcttcg
tcctcctcctcctcctcctcctcctctcacccccctgtggtaagaccaatgggcctgcag
aactctgaagagaacgcccggatctccatcaccttcttccggctcttccgtgtgatgcgt
ctggtgaagctactctcccgtggggaagggatccggacgctactgtggaccttcatcaag
tccttccaggctctaccttacgtcgccctgctgattgtgatgctgttttttatttacgcc
gtcattggcatgcagatgtttggcaagatagcgctgcgggaccacacgcagatcaacagg
aacaacaatttccagacgttcccccaggcagtgctgctgctcttcagatgtgccacaggc
gaagcgtggcaggagatcatgctggcgtgctcgctctatcggccgtgcgagaaaggatcc
accaatgagaacgtcgccatccaggaggactgcgggagccagttcgccatcatctacttt
gtcagcttctacatgctctgtgcctttctgatcatcaatctcttcgtggctgtcatcatg
gacaactttgactacctgacgcgggattggtccatcctggggccgcatcaccttgacgag
ttcaagaggatatgggccgaatacgacccggaagcaaaggggaggatcaagcacctggat
gtggtgactctgctcagaaggatccagcccccgctcggcttcgggaagctctgtcctcac
cgggtggcctgcaagcgtctggtctccatgaacatgccgctgaacagcgacggaaccgtc
atgttcaacgcgacgctctttgcgctggtcagaacggcactgaggatcaagacagaaggg
aatctggagcaggccaacgaggagctgagggccatcgtgaagaagatctggaagaggaca
agcatgaaactgctggatcaagtggtgccacctgctggcgacgacgaggtcacggtcgga
aagttctacgccaccttcctcattcaggagtacttccgcaagttcaagaagaggaaagaa
caagggctggtggccaaagtgccgcccaaaacggccctctccctgcaggcgggcctgcgg
acgttgcacgacatcggtccggaaatcaggagggccatctccggggacctgacggtggag
gaggaggtagacaaaggcccgaaggagcccgtatcggccgcatccgaggacgatatcttc
agggtaaagcggtcaggcggcttgttcggaaaccacgtcaactattacaaccagagcgac
ggccgcgcctccttcccgcaatcgttcaccacccagcgtcccttgcacatcagccagaag
ggctcgccctgcgaaggcgacagcccctcccacgagaagctcatggactccaccaccttc
acgccgtcctcgtactcgtcgtcgggctccaacgccaacatcaacaacgccaacaacacc
ggcatggtgggcgtggccccgcagggcggcggccgcttcccgggctcgtccgtcagcacg
gtggacggccacgcgggacagccgctgacgcccgtcctgctgcccagatcggcttggtgc
ttccctcccaagaggacgtgtttttttgacaacctccttcgctccgactcgagcgacagc
cgcctgcccatcatccgcaggggcgaggggtccacggaggagacgtacgacgaaagctac
gccgacgagagggagttccaagaagacgaccactcgctctcctccgacatgctggtgtac
cgcgacgacacctgcaagcagctgactcccatggaggaaggagacgacatggaggagaga
agaggagttggggggtggcaatcccccagaagagtctttctatgtcccacctctttagga
cggagatcttcgttccatttagagtgtctgaggaggcagtcgagggcggacgtctctcag
aagacggccgtgccgctgcacctcgtccatcatcaggcgctcgccgtggccgggctgagt
ccgttgatcaggaggagccactcgcccaccctcttcagccggctgtgctccacgcctccg
gccagtcccgcagagcaaggcagcgacgcctcgtatcagcgcgtaccctccctgaggtta
gagggctccaactcccatgaaaagctcaacgccagcttgccctcggtcaattgcgggccc
tggtataccgacagtaatgggaacagtcgggtacccagtcctagccccgcctccggcatg
cccacaaccaatcagagagcggcacggccagtgtcgctcacggtgccctcgctattgggc
cacgactccagctcgtcgcacggcagcgcgggaagtctggtggaggcggtgctcatatca
gaaggcttgggccagttcgcgcaggacccctccttcatcgaggccaccaaggccgagctg
gccgacgcctgcgacatgaccatcgaggagatggagcacgccgccagcaacatcctcaac
ggcaacgcccccgcatcggacgccaccgcgcccgtcgcctcccagcacagccccaacggc
aacttccacagggacagggaccgaggggcggaggatggcggggaggccggcggtaaccga
ggctccgtccacggcccgtcctctgtggaagagcggcaggagctgctagcgggggcgcgg
ggacaggaagaagaggacgatgacgaggaggaggaggaggaggaggaagtcggggggagg
gaggagggacaccaccgaagctccgcggcgatggcgggagcgcggcagaggaccagcggg
ctgctggaggacgaggacatggaatgcgtgaccagtttgtag

DBGET integrated database retrieval system