KEGG   Hippocampus comes (tiger tail seahorse): 109520372
Entry
109520372         CDS       T04969                                 

Gene name
serpine1
Definition
(RefSeq) plasminogen activator inhibitor 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
hcq04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109520372 (serpine1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109520372 (serpine1)
   04218 Cellular senescence
    109520372 (serpine1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hcq01002]
    109520372 (serpine1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109520372 (serpine1)
   00536 Glycosaminoglycan binding proteins [BR:hcq00536]
    109520372 (serpine1)
Peptidases and inhibitors [BR:hcq01002]
 Peptidase inhibitors
  Family I4: serpin family
   109520372 (serpine1)
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109520372 (serpine1)
Glycosaminoglycan binding proteins [BR:hcq00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   109520372 (serpine1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 109520372
NCBI-ProteinID: XP_019733103
UniProt: A0A3Q2YLF0
LinkDB
Position
Unknown
AA seq 392 aa
MFCKYVIVVLLAAVSGGAVMGSLQDKQTNLGLKVFGHLARASAHRNVLFSPYGVSSVLAM
AQLGAAGNTRKAMTAAMGFSLQERGMSRQQRFLQRDLHAEDGLELASGVMVERKMSLEKG
YRQALSKAFRSHPHQLDFTKPDQAVEVINAWVLDHTAGAIPEFLARGSLSEETRLVLLNA
LHFQGLWKVPFDPKLTHERMFHSANGSSVPIHMMTLTNRFNYGEFVTPSGVDYDVVEVPY
EGDSLSMLLVSPFEADVPLSALSDDLSSQRIRQWRAELRSVRRKLTMPRFTLNSEVNLKA
ALISMGLGNMFNLATADFTRITTDERLCVSKVLQTVKLEVNEQGTKGAAATAAVLFSRMA
VEELTLDRPFLFLIQHKPTGAILFMGQFNHPA
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgttttgcaagtacgtgatcgttgttctcttggcggccgtgagcggcggggccgtgatg
ggctctctgcaggacaaacagaccaacttgggcttaaaggtcttcggccatttggccaga
gcttcggcgcaccggaacgtgcttttctccccgtatggcgtttcctccgtcctggcgatg
gcgcagctcggcgcggcggggaacactcgcaaggccatgactgccgcaatgggattttcc
ctgcaagagcgcggaatgtctcgacagcagcgcttcctgcagcgcgacctccacgccgag
gatggtttggagttggccagcggagtcatggtggagaggaagatgagcctggagaaagga
taccgccaggccctgtccaaggccttcaggagccacccgcaccaattggacttcaccaag
cccgaccaggcggtggaagtcatcaacgcctgggttttggaccacactgcaggcgccatt
cctgagttcttggcccggggatcgctgagcgaagagacgcgcctggtgctcctcaatgcc
ctccacttccagggactctggaaggttccgttcgaccccaagctcacgcacgagagaatg
ttccacagcgccaatggcagctccgtacccattcacatgatgacactcaccaaccgcttc
aactacggggagtttgtgactcccagcggcgtggactatgatgtcgtggaggtcccgtat
gagggcgactcgctgagcatgctgctggtgtcgcctttcgaagccgacgtgccgctcagc
gccctcagcgatgacctgagcagccagcggatccggcaatggagagccgagctcaggagc
gttcggagaaagttgaccatgcccaggtttactctgaactcggaggtgaacttgaaggct
gcactcatcagcatgggcctggggaacatgttcaatctggccactgccgatttcacccgc
attacaaccgacgagaggctttgcgtgtccaaggttctccagacagtcaagcttgaggtc
aacgagcaaggaacaaagggagcggcggcaacagccgctgtgctattttcccgaatggca
gtggaggagctcactttggatcggccttttctcttcttgatccagcacaaaccaacgggg
gccattttgttcatgggccagttcaatcatcccgcttaa

DBGET integrated database retrieval system