KEGG   Hippocampus comes (tiger tail seahorse): 109520402Help
Entry
109520402         CDS       T04969                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00590  Arachidonic acid metabolism
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    109520402
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109520402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosducin An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 109520402
NCBI-ProteinID: XP_019733152
LinkDB All DBs
Position
Unknown
AA seq 902 aa AA seqDB search
MSSSILGYFCILLLLREPACSGDEVMSDTVNPCCYLPCQHQGVCVRYADNRYECDCTRTG
YHGENCTIPEFWTRVRDLLKPGADTVHYILTHFRWLWDVINNTFLREVLMRLVLTVRSNL
IPSPPTYNSKYGYLSWESYYNLSYYTRILPPVPEDCPTPLGVKGKAGLPDPELLVEKLLK
RRTFRPDPQGSNLMFAFFAQHFTHQFFKTYNRMGLGFTKALAHGVDAGHVYGDNLERQLN
LRLLKDGKLKYQLIDGEMYPPSVAEAPIKMSYPPGVDPKDQLAIGHEVFGLLPGLGLYAT
LWLREHNRVCDVLKAEHPSWDDEQLFQTARLIIIGETIRIVIEEYVQHLSGYLLQLKFDP
TLLFHAQFQYGNRIALEFSQLYHWHPLMPDSFHINGDELVYTQFLFNTSVLTHYGVDKLV
DAFSRQVAGQIGGGHNVNPVVTPVAVRTIKESRQLRMQPFNEYRKRFNLKPYASFREFTD
NEEIALTLEEFYGDIDALEFYPGMLLERTRLGAIFGESMVEMGAPFSLKGLLGNPICSPE
YWKPSTFGGRVGFDIVNSATLKNLVCLNSRTCPYVAFRVPPEEQSVRADELAIAMTTLDD
KLLGEKLQYYYSSSEDEGSDNEDNERDTKAIRDSAANEPELDYSADGSAVNTGPKGVIND
WRKYKQLEVEQKQEQKKEMERLIKKLSMTCRSDLDLEKEKQKQKELQDKIKGKMTMQEYN
MLQQEEDDEDFLQHYRAQRMEEMRRQLCRGKRFERVQELASGEDFLEALDEEDKNTPVMI
HIYEPGAAGCEAMSGSLACLAHEYPLVKFCSVRSSAIGTSPLFRDGALPALLVYKAGELI
GNFVRLTDQLGEDFFAVDVEALLQEYGLLPDKVPTLAKTVRNGAIVQSNLSDDDDDSDLD
ID
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgagttcctctatcctgggatacttctgcattcttctattgctgcgggaacctgcgtgt
agtggggatgaggtgatgtccgacacagtgaacccgtgctgctacttgccgtgtcagcac
cagggcgtgtgcgtaagatacgcagacaatcgctacgagtgcgactgcacccgcaccggc
taccatggggagaactgcaccatcccggagttctggactcgggtgcgtgacctcctgaag
cccggagcggacacggtgcactacattctcacccacttccgctggctctgggacgtcatc
aacaacaccttcctgcgggaagttctgatgcggcttgtcctgacagtgaggtccaactta
attcccagccctccaacgtataattcaaaatacggttacctcagctgggagtcctactac
aacctaagctactacactcggattcttccgccagtgccagaagactgcccgacacctctg
ggtgtcaaagggaaagctgggctgcctgaccctgagctgctagtggagaagctgctaaaa
agaaggacattcaggcctgacccgcagggctccaacctcatgttcgccttctttgcacag
cacttcacacaccagtttttcaagacctacaaccgcatgggcctgggcttcacaaaggcc
cttgcgcatggggtggatgcgggacacgtttacggagataacctggagcggcaactgaat
ctccggcttttaaaagatggaaaacttaaatatcagttgattgatggcgagatgtaccct
ccctctgtagccgaagcccccatcaagatgagctaccccccaggtgtggaccccaaggac
cagttagctatcggccatgaagtattcggacttctccccggcttaggattgtatgccacg
ctgtggttgagggagcacaaccgagtctgcgacgtcctgaaagcggagcatcccagctgg
gatgacgagcagctattccagaccgcgcggctcatcatcattggtgagaccatccgaata
gtgatcgaagaatatgttcagcacctcagcggctacctgctgcagttaaagttcgacccc
accctgctctttcacgcccagttccagtacgggaaccgcatcgccctggagttcagccag
ctctaccactggcaccccttgatgcccgatagcttccatatcaacggggacgagctcgtc
tacacgcagttcctcttcaacacgtccgtgctcacgcactacggcgtggacaagctggtg
gacgccttctcccgccaagtggccggccagataggcgggggccacaacgtcaatcctgtg
gtgacgccggtagccgtgaggaccatcaaggagtcgcggcagctccgcatgcagcccttc
aacgagtacaggaaacgctttaatctcaagccgtacgcttccttcagagagttcacagat
aacgaggagatagcgctcactctggaagagttttacggcgacattgacgctcttgaattt
taccccggcatgctgctggagaggactcgtctgggcgccatcttcggcgagagcatggtg
gagatgggtgcgccgttctccctcaaaggcctcctgggcaaccccatctgctcccccgag
tactggaagcccagcactttcgggggccgcgtgggcttcgacatcgtcaactcggccacg
ctcaagaacctggtgtgcctcaattccaggacgtgcccttacgtggcgtttcgagtgccg
ccagaggagcaaagcgtcagggcggatgagctggccattgccatgacgacgctagacgac
aagctgctgggggagaagctgcagtactactacagcagcagcgaggatgaaggcagcgat
aatgaggacaatgagagggacaccaaagccatccgagacagcgccgccaatgagcctgag
ctggactacagtgcggatggcagtgcggtcaacacaggaccaaagggtgtcatcaatgac
tggaggaagtacaagcaactggaggtggagcagaagcaggagcagaagaaggagatggaa
cgcctgatcaagaagctgtccatgacgtgccgctccgacctggacctggaaaaagagaag
cagaagcagaaggagctgcaggacaaaatcaaaggcaaaatgaccatgcaggagtacaac
atgctccagcaggaagaggacgatgaggacttcctgcagcactatcgcgcgcagcgcatg
gaggagatgcggcggcagctatgccgtgggaagcgctttgagcgcgtccaggagctggcc
agcggcgaggacttcctggaggcactggatgaggaggacaagaacacaccagtcatgatc
cacatctacgagcccggcgcggccggctgcgaggccatgagcggcagcctggcgtgcctg
gcgcatgagtatccactggtcaagttctgtagcgtgcgcagctcggccatcggcaccagt
ccgctcttccgggatggcgccctgcctgccctgctagtctacaaagccggagagctcatc
ggcaacttcgtacggctcaccgaccagctcggtgaggacttcttcgccgtggatgtggaa
gcgctgctgcaggagtacggtctgctgcctgacaaggtccccaccctggccaagaccgtc
cgcaacggcgccatcgttcagagcaacctcagcgacgacgacgacgattctgacctcgac
atagactag

DBGET integrated database retrieval system