KEGG   Hippocampus comes (tiger tail seahorse): 109520533
Entry
109520533         CDS       T04969                                 

Definition
(RefSeq) caspase-8-like isoform X1
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04217  Necroptosis
hcq04620  Toll-like receptor signaling pathway
hcq04621  NOD-like receptor signaling pathway
hcq04622  RIG-I-like receptor signaling pathway
hcq04625  C-type lectin receptor signaling pathway
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109520533
   04217 Necroptosis
    109520533
   04115 p53 signaling pathway
    109520533
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109520533
   04621 NOD-like receptor signaling pathway
    109520533
   04622 RIG-I-like receptor signaling pathway
    109520533
   04625 C-type lectin receptor signaling pathway
    109520533
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109520533
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109520533
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hcq01002]
    109520533
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     109520533
Peptidases and inhibitors [BR:hcq01002]
 Cysteine peptidases
  Family C14: caspase family
   109520533
SSDB
Motif
Pfam: Peptidase_C14 DED Pox_VLTF3
Other DBs
NCBI-GeneID: 109520533
NCBI-ProteinID: XP_019733386
LinkDB
Position
Unknown
AA seq 494 aa
MERRKLMEISEALASSEVAALCFLCRDVLNCRHLEGVNDAKVLFSRLEERDCQNPEFLHQ
LLHTIRRNDLLSLLKGNRQNVEETDANPIGKLSNYRVMLYQIYDETTKEDLQKMKFLLND
KIGRRQMDECSTALDVFVELEKVGLLSQSDLQALHSILMEVNRQLASTVEQFAQGAPVEA
ASPPPARPLNGFQHVNNSPLESISETGASNDGGHFPSDAETNPEPSSLSDQTEYYAMNHI
PHGVCVIINNEEFLVKELTKRGGTQADERALDSLFSKFGFQVIVYSNLTAAEIRRELKDI
ATRNFSEDDALVVCVLSHGAKGCVHGTDGETVSLQELTQPFTSGFVPTLAGKPKLFFIQA
CQGKAFQTGFLPWSSKPREVAEDTRNQVETDAGPIPDETVASDADFLLGMATVPDCKSFR
NTNTGSIYIQELCKQLRRSAVSPQGEDILTVLTRVNREVSRGVFLNAKQMPQPKYTLTKT
LILRFADEDQVKLS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggagaggcggaagttgatggaaatctccgaggccctggcttcctctgaagtggccgca
ctctgcttcttgtgccgtgatgttcttaactgcagacatctcgaaggagtcaatgacgca
aaggttctgttcagtagattggaagaaagagattgccagaatcctgaatttcttcatcag
ttactgcacacaatccgacggaatgatctcctcagcctcttaaaggggaacagacagaat
gtggaggaaactgatgccaatcctatcggcaagctgtcaaattacagggtgatgctgtat
cagatatatgatgaaacgacgaaagaagatctccaaaagatgaagtttctcttaaacgac
aagattggcaggagacaaatggatgaatgcagtacggcgctggacgtctttgttgaatta
gaaaaagtgggtttgctgtctcaatcagatctacaagcgctgcattcaatactgatggaa
gtgaatcgacagctggcatcgactgtcgagcaattcgcgcaaggtgcacctgtggaggca
gccagtccacctcctgctcgccccctcaatggtttccagcatgtcaacaactcccctctt
gagtccatatctgagactggagccagcaatgatggtggccattttccctcagacgccgaa
acaaaccccgagccttcttcgctttctgatcagaccgagtactacgcaatgaatcacatc
cctcatggtgtctgtgtaatcatcaacaacgaggaatttttggttaaggagctgacaaaa
aggggtggaactcaagcggacgagagggctcttgactcactgttctccaaatttggcttc
caagtgattgtctatagcaacttgacagcagcagaaataagaagggagctaaaggacatt
gctacgagaaacttttctgaggatgatgctctggttgtgtgtgtgctctcccatggggcc
aaaggctgtgtccatgggacagacggggaaacagtttctttacaagaactgacgcagccc
tttacaagtggatttgtccccaccttggcaggaaaacctaaactgttcttcatccaagcg
tgtcagggaaaagccttccagactggattcttgccatggtcctcaaagccaagagaggtt
gctgaggacacacggaatcaagtggaaacggatgcgggccccatcccggatgagacggtg
gcctcggatgccgactttctgctcggcatggccactgtgccagattgcaagtcctttcga
aatactaacacgggttccatctacatccaagagctgtgcaagcaactcagacgatctgct
gtgagtccacagggggaagatattctcactgtcttgacacgggtgaatagggaggtcagc
agaggagtgtttttaaacgccaagcaaatgcctcagcccaaatacaccctcactaagaca
ttgattctaaggtttgctgatgaggaccaagtgaaactttcctaa

DBGET integrated database retrieval system