KEGG   Hippocampus comes (tiger tail seahorse): 109520621Help
Entry
109520621         CDS       T04969                                 

Definition
(RefSeq) glutamate decarboxylase 1-like isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00250  Alanine, aspartate and glutamate metabolism
hcq00410  beta-Alanine metabolism
hcq00430  Taurine and hypotaurine metabolism
hcq00650  Butanoate metabolism
hcq01100  Metabolic pathways
Module
hcq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109520621
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109520621
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109520621
   00430 Taurine and hypotaurine metabolism
    109520621
Enzymes [BR:hcq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109520621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 109520621
NCBI-ProteinID: XP_019733538
LinkDB All DBs
Position
Unknown
AA seq 582 aa AA seqDB search
MATSEPRTTSGEQDPNTANLRPSSTTYEYAWMHGCTRKLGMRICGFLQKNNSLEEKGRLS
QKNLLSCDNSDRDARFRRTETDFSNLFARDLLPAKNGEEPTMQFLLEVVDILTNYVKKTF
DRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGHPRFFNQLS
SGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREMIGWPGGEGDGLFSPGG
AISNMYSVMIARYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAALGFGTENVILLS
TDERGRVIPADLEAKIIDAKQKGYVPLFVNATGGSTVYGAFDPINEIADICEKYNLWLHV
DGAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVPLQCSAILVREKGLMGGCNSMCA
GYLFQQDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTTGFEQHIDRCLDLSQYLYN
KIKNREGYEMVFDGVPQHTNVCFWYIPPSLRGMPDSEERREKLHRVAPKIKAMMMESGTT
MVGYQPQGNKVNFFRMVVSNHAATQSDIDFLIDEIERLGRDL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtcagagccgagaaccaccagcggggaacaggaccccaacaccgccaattta
agaccctcatccacaacctacgaatatgcgtggatgcatggctgtacaaggaaactgggc
atgaggatttgtgggttcctgcagaaaaacaacagcttggaggagaagggcagactgagt
cagaagaacctgctctcctgcgacaacagtgacagggacgctcggttccgacgcaccgag
accgacttctcaaacctgtttgcccgagacctgttgcctgcaaagaatggcgaggaacca
accatgcagtttttactggaggtggttgacatactgaccaactacgtgaagaagacattc
gaccgctccaccaaggtgctggacttccaccaccctcaccagctcctggagggcatggag
ggcttcaacctggaactgtccgaccagcccgagtctctggagcagatcctggtggactgc
agggacacgctcaaatatggtgtgcggacaggtcaccctcgtttcttcaaccagttgtcc
tcgggtttagacatcatcggtctggcaggggagtggctcacctcgactgccaacaccaac
atgtttacttacgagatcgctccggtgtttgttttaatggagcagctgaccctgaagaag
atgagagagatgattggctggcccggtggcgagggagacggccttttctcgccagggggc
gctatttctaacatgtacagtgtgatgatcgctcgttacaagtatttccccgaggtcaag
accaagggcatgtctgctgctcctcgtctggttctgttcacatcggaacatagccactac
tccatcaagaaagccggtgctgctctgggatttggcaccgagaatgtgattctgctgagc
acggatgagagggggagggtcattcctgcggatctggaggctaagatcattgacgccaaa
caaaagggttacgtgccattatttgtgaacgccaccggtggctccaccgtctacggtgcc
tttgaccccatcaatgagattgcggacatttgcgagaagtacaacctgtggctgcacgtt
gacggagcgtggggtggcggcctgctgatgtccaggaagcaccgccataaactcaacggg
attgagagagccaactctgtcacgtggaaccctcacaagatgatgggcgtgccgctccag
tgctccgccatcctcgttagggagaagggactgatgggcgggtgcaactccatgtgcgcc
ggttatttgttccaacaagacaagcagtacgacgtcacgtacgacactggggacaaagcc
atccaatgtggccggcatgtggacatatttaagttctggctcatgtggaaggcgaagggc
accactgggtttgagcagcacattgacaggtgcttggatttgtctcagtacctgtacaac
aagatcaagaacagggaggggtatgagatggtgtttgatggcgtgcctcagcacaccaac
gtttgcttctggtacatcccacccagcctgaggggaatgccagacagtgaggagaggcgg
gagaagctccacagagttgcaccaaagatcaaggccatgatgatggagtcaggtaccacc
atggtgggctaccagcctcagggcaataaagtcaacttcttccgtatggtcgtctccaac
catgcggccacccaatctgacatcgacttcctcattgatgagatagagaggctgggtcgt
gacctgtag

DBGET integrated database retrieval system