KEGG   Hippocampus comes (tiger tail seahorse): 109520795Help
Entry
109520795         CDS       T04969                                 

Definition
(RefSeq) probable histone deacetylase 1-B isoform X1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04110  Cell cycle
hcq04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    109520795
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    109520795
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109520795
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     109520795
   HDAC complexes
    Sin3A-HDAC complex
     109520795
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109520795
  Chromatin remodeling factors
   NuRD complex
    109520795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 109520795
NCBI-ProteinID: XP_019733848
LinkDB All DBs
Position
Unknown
AA seq 489 aa AA seqDB search
MALSQGTKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAS
GEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSGGGSVAG
AVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLGG
GGYTIRNVARCWTYETAVALDTSIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEEEEDPNKRISIRAHDKRIACEEEF
SDSEDEGEGGRRNTANFKKAKRAKTEGEKESEEKEKKGEEETKEVKDEEKAPDEEKMDTS
KPKEESKTP
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttagtcaaggaacaaagaaaaaagtttgctactattacgacggtgatgttgga
aattattactatggacagggtcatcccatgaagccccaccgcatccgcatgacacacaac
ttgctgctcaactatggcctctacagaaagatggagatatatcgtccacacaaagccagc
ggcgaggagatgaccaagtatcacagtgatgattacatcaaattcttgcgctccatccgt
ccagacaacatgtcagagtacagcaaacagatgcagcggttcaatgtaggagaagattgt
ccagtatttgatggcttgtttgagttttgccagctctcaggaggcggctctgttgccggt
gctgtcaagttgaacaaacagcagacagacatagcgatcaactgggcaggcggtctgcat
cacgccaagaagtctgaggcctctgggttttgctacgtcaatgatattgtcctggctata
ctggagttactcaagtaccaccagagagttctctacatagacatcgacatccatcatgga
gatggtgtggaggaggcattctacaccacagaccgtgtcatgactgtgtcattccacaag
tatggagagtacttccctggcactggtgacctgagagacattggtgctgggaagggcaaa
tattatgctgtgaattaccctctgagagatgggattgatgacgagtcttatgaagccata
ttcaagcctatcatggccaaggtaatggagatgtaccagcccagtgctgtggttctgcag
tgtggcgcagattctctgtcaggcgatagactcggctgctttaacctcaccattaaagga
catgccaagtgtgtggagtacatgaaaagcttcaacctgcctctcctcatgctgggagga
ggcggctacaccatccgaaatgtcgcacgctgttggacttatgaaaccgctgtcgctctc
gatacgtcaatcccgaatgaactcccatacaatgactactttgagtactttgggccagac
ttcaagctgcacatcagcccctccaacatgactaaccagaacaccaatgattacctggag
aagataaagcagcgtttatttgagaacctacgcatgctgccccacgctccaggggtacag
atgcaggccatccctgaagacgccgtacaggaggatagtggagacgaggaagaggaggat
cccaacaaacgcatctccatccgtgctcatgacaagaggatagcgtgtgaggaagagttc
tctgactcggaggatgaaggtgaaggaggtcgcagaaacacagccaacttcaagaaggcc
aagcgagccaagaccgaaggagagaaagagagtgaagaaaaggagaagaaaggtgaggag
gaaacaaaagaagtcaaagatgaggagaaggcaccagatgaggagaaaatggacacatca
aagccaaaagaggagtcgaagacaccttaa

DBGET integrated database retrieval system