KEGG   Hippocampus comes (tiger tail seahorse): 109520991
Entry
109520991         CDS       T04969                                 

Gene name
ccne2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04110  Cell cycle
hcq04114  Oocyte meiosis
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109520991 (ccne2)
   04114 Oocyte meiosis
    109520991 (ccne2)
   04115 p53 signaling pathway
    109520991 (ccne2)
   04218 Cellular senescence
    109520991 (ccne2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hcq03032]
    109520991 (ccne2)
   03036 Chromosome and associated proteins [BR:hcq03036]
    109520991 (ccne2)
DNA replication proteins [BR:hcq03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109520991 (ccne2)
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109520991 (ccne2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109520991
NCBI-ProteinID: XP_019734131
LinkDB
Position
Unknown
AA seq 398 aa
MSRRSGRITLQARDSNTLEPTIRAPLRKRKCEQPSKKSQPTAKKQSCYEIQKCWSEDGAS
PCVLIETPHKELEPADPSNFKQYRFKNLFIKASPLPCLSWASSDDVWIKMLNKELKYVHD
KNYMQRHHKLQPSMRAILLDWLLEVSEVYCLHRQTAYLAQDFFDRFMLTQEDVNKDYLQL
IGITALFIASKIEEIYPPKIGEFAYVTDGACDSWDIRRTELHILKALDWNLCPETPISWL
KLYAQVEAQKDDENFLVPQFSQEMYIQITQLLDLCMMDIRSLDFSYSVLAAAAFCHFSTF
DIVNKVSGLTWESVSECVRWMNPFMDTLRSEAKPELKTFAKVKTEDRHNIQTHVTYLDFL
RKAQERHVLEVADCPLSPVVAVPPVLTPPSSTEKPANH
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtccagacgcagtggtcgcatcacccttcaagccagagactcaaacacgctcgaaccc
accatcagagcgccactgagaaaaaggaagtgcgagcagccctccaagaagagtcaaccc
actgccaagaaacaaagctgctatgaaattcagaagtgttggtcagaggacggagcgagt
ccgtgcgtcctcatcgaaacgccgcacaaagaactggaacccgccgacccatccaacttc
aagcagtaccgcttcaagaacctcttcatcaaggcttcgcccctaccttgtctcagttgg
gccagctcggatgacgtgtggatcaagatgctcaacaaggagctcaagtacgttcacgac
aagaattatatgcagcggcaccacaaactgcagcccagcatgagggccattctcctggac
tggctactggaggtgagcgaagtgtactgcctccaccggcagacggcttacttggcacag
gacttcttcgaccgcttcatgctgacccaggaggacgtcaacaaggactacctgcagctc
atcggcatcaccgcgctgttcatcgcctccaagattgaggagatctaccctcccaaaatc
ggcgagtttgcctacgtgacggatggcgcgtgtgactcgtgggacatccggcgcacagag
cttcacatcctcaaggcattagactggaatctttgtccggagactcccatctcttggctg
aagctctacgctcaggtggaggcacagaaggacgacgaaaacttcctggtgccacagttc
tcgcaggaaatgtacatccagatcacacagctgctggatttgtgcatgatggatatccgc
tcgttggacttcagctacagcgtcctcgccgccgccgccttctgccatttctccaccttc
gacatcgtcaacaaagtgtccggcctgacgtgggaaagcgtgtccgagtgcgtgcggtgg
atgaaccccttcatggacacgctgcgttcggaggccaaacctgagctcaagacttttgcc
aaggtgaagaccgaagacagacacaacatccagacacacgtcacctacttggacttcctg
agaaaagctcaagagcgccacgttctggaagttgcagactgcccgctatcgccagtggtt
gctgtgccgcccgtcttgactccgcccagcagcacggaaaaaccagcgaatcactga

KEGG   Hippocampus comes (tiger tail seahorse): 109524515
Entry
109524515         CDS       T04969                                 

Definition
(RefSeq) G1/S-specific cyclin-E1-like
  KO
K06626  G1/S-specific cyclin-E1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04110  Cell cycle
hcq04114  Oocyte meiosis
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109524515
   04114 Oocyte meiosis
    109524515
   04115 p53 signaling pathway
    109524515
   04218 Cellular senescence
    109524515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hcq03032]
    109524515
   03036 Chromosome and associated proteins [BR:hcq03036]
    109524515
DNA replication proteins [BR:hcq03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109524515
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109524515
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109524515
NCBI-ProteinID: XP_019740006
LinkDB
Position
Unknown
AA seq 365 aa
MLGSREVTDQEAQCVASEAANVKTARPRKRKADVAIYLQDVDEDAAEMTKKKQRDCEAAW
RSKEGAYASPPRGLSTLDGKDEREQQITLINAGFPHYNLTNVFATPVHCAPLPALCWASK
DVVWNNMLAKDKTYTRNVNMMAKHPHLQPKMRAVLLDWLMEVSEVYKLHRETYHLAQDYF
DRFMATQTNVFKSTLQLIGISCLFIAAKVEEMYPPKVHQFAYVTDEACTEDEILSMEVII
MKELKWSLSPQTPVSWLNVYMQVAYLKESDQLLIPKYPQATFTHIAELLDVCMLDMRCLE
FSNGVLAASALFHFSSLELVENVSALKRAELEECVRWMVPFAVALRESGGSPMKTFSGVA
AQMVR
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgggaagtcgggaagtcactgatcaagaagcccagtgtgttgctagcgaggcggcc
aacgtcaagacggcgaggccgaggaagaggaaagcagatgttgccatttatttacaagat
gtggatgaggacgcggcagagatgaccaagaagaagcagcgagactgtgaggcggcctgg
cggtccaaggagggtgcgtacgcaagtcctccgcgcgggttgtccacgctggatggcaaa
gacgagcgtgagcagcagatcaccttgatcaacgccggcttcccgcactacaacctcacg
aacgtctttgctacgcccgtacattgcgcgccgctgcctgcgctctgctgggcgagtaag
gacgtggtgtggaacaacatgctggccaaggataagacatacacgcgcaacgtcaacatg
atggccaaacatcctcaccttcagcccaagatgagagctgtgctgctcgactggctcatg
gaggtgagcgaggtgtacaagcttcaccgcgagacgtaccacctggctcaggactacttt
gaccgcttcatggccacgcagaccaacgtcttcaagtccacgctgcagctcatcggaatc
agctgccttttcatcgcagccaaagtcgaagagatgtaccctcccaaagtgcaccagttt
gcctacgtgacggacgaagcctgcaccgaggacgagatcctcagcatggaggtcatcatc
atgaaggagctgaagtggagtctgagcccgcagacgcccgtctcctggctcaacgtctac
atgcaggtggcctacctcaaagagtcggaccagctgctcatccccaaatatccgcaggcc
acctttacgcacatcgccgagctcctggatgtgtgcatgctcgacatgcgctgcctggaa
ttctccaacggcgtcttggccgcctcggccctcttccacttctcgtccctggagctggtc
gagaacgtgtcggcgttaaaaagggcggagctggaggaatgcgtgcggtggatggtgccg
ttcgccgtggcgctgcgcgagtcgggcggctcgcccatgaagaccttctccggcgtagct
gcccagatggtccgctag

KEGG   Hippocampus comes (tiger tail seahorse): 109524571
Entry
109524571         CDS       T04969                                 

Definition
(RefSeq) G1/S-specific cyclin-E1-like
  KO
K06626  G1/S-specific cyclin-E1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04110  Cell cycle
hcq04114  Oocyte meiosis
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109524571
   04114 Oocyte meiosis
    109524571
   04115 p53 signaling pathway
    109524571
   04218 Cellular senescence
    109524571
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hcq03032]
    109524571
   03036 Chromosome and associated proteins [BR:hcq03036]
    109524571
DNA replication proteins [BR:hcq03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109524571
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109524571
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109524571
NCBI-ProteinID: XP_019740099
LinkDB
Position
Unknown
AA seq 436 aa
MLGSREVTDQEAQCVASEAANVKTARPRKRKADVAIYLQDVDEDAAEMTKKKQRDCEAAW
RSKEGAYASPPRGLSTLDGKDEREQQITLINAGFPHYNLTNVFATPVHCAPLPALCWASK
DVVWNNMLAKDKTYTRNVNMMAKHPHLQPKMRAVLLDWLMEVSEVYKLHRETYHLAQDYF
DRFMATQTNVFKSTLQLIGISCLFIAAKVEEMYPPKVHQFAYVTDEACTEDEILSMEVII
MKELKWSLSPQTPVSWLNVYMQVAYLKESDQLLIPKYPQATFTHIAELLDVCMLDMRCLE
FSNGVLAASALFHFSSLELVENVSALKRAELEECVRWMVPFAVALRESGGSPMKTFSGVA
AEDVHNIQTHAPYLTWLEKAASYQDADLEPHRGCQVPSGVLTPPLSIEKTDEHPKAATAA
LQVPPRMRAAEWTLAP
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgctgggaagtcgggaagtcactgatcaagaagcccagtgtgttgctagcgaggcggcc
aacgtcaagacggcgaggccgaggaagaggaaagcagatgttgccatttatttacaagat
gtggatgaggacgcggcagagatgaccaagaagaagcagcgagactgtgaggcggcctgg
cggtccaaggagggtgcgtacgcaagtcctccgcgcgggttgtccacgctggatggcaaa
gacgagcgtgagcagcagatcaccttgatcaacgccggcttcccgcactacaacctcacg
aacgtctttgctacgcccgtacattgcgcgccgctgcctgcgctctgctgggcgagtaag
gacgtggtgtggaacaacatgctggccaaggataagacatacacgcgcaacgtcaacatg
atggccaaacatcctcaccttcagcccaagatgagagctgtgctgctcgactggctcatg
gaggtgagcgaggtgtacaagcttcaccgcgagacgtaccacctggctcaggactacttt
gaccgcttcatggccacgcagaccaacgtcttcaagtccacgctgcagctcatcggaatc
agctgccttttcatcgcagccaaagtcgaagagatgtaccctcccaaagtgcaccagttt
gcctacgtgacggacgaagcctgcaccgaggacgagatcctcagcatggaggtcatcatc
atgaaggagctgaagtggagtctgagcccgcagacgcccgtctcctggctcaacgtctac
atgcaggtggcctacctcaaagagtcggaccagctgctcatccccaaatatccgcaggcc
acctttacgcacatcgccgagctcctggatgtgtgcatgctcgacatgcgctgcctggaa
ttctccaacggcgtcttggccgcctcggccctcttccacttctcgtccctggagctggtc
gagaacgtgtcggcgttaaaaagggcggagctggaggaatgcgtgcggtggatggtgccg
ttcgccgtggcgctgcgcgagtcgggcggctcgcccatgaagaccttctccggcgtggct
gccgaagacgtgcacaacatccagacgcatgccccctacctgacgtggctggagaaggcg
gcgtcttaccaggacgcggacttggagcctcatcgcggctgtcaggtaccgtccggcgtc
ctcacgccgcctcttagcatcgagaagacggacgaacaccccaaagcggccaccgccgcg
ctacaagtgccccccaggatgcgtgcggccgaatggacgctggccccatag

DBGET integrated database retrieval system