KEGG   Hippocampus comes (tiger tail seahorse): 109521170
Entry
109521170         CDS       T04969                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04140  Autophagy - animal
hcq04141  Protein processing in endoplasmic reticulum
hcq04210  Apoptosis
hcq04217  Necroptosis
hcq04261  Adrenergic signaling in cardiomyocytes
hcq04340  Hedgehog signaling pathway
hcq04510  Focal adhesion
hcq04621  NOD-like receptor signaling pathway
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109521170
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109521170
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109521170
  09143 Cell growth and death
   04210 Apoptosis
    109521170
   04217 Necroptosis
    109521170
   04115 p53 signaling pathway
    109521170
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109521170
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109521170
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109521170
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109521170
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109521170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hcq01009]
    109521170
Protein phosphatases and associated proteins [BR:hcq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109521170
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 109521170
NCBI-ProteinID: XP_019734389
LinkDB
Position
Unknown
AA seq 297 aa
MFPLRTKAQNGRPPLLRFSDWIKTLAVKSIRPIRERAVSHLPTLFLSSAPLTLRKDWQSH
RAAGVCGVGAGVQLQEENNVCHNLSKRGYAWGFGAAPEQGEEDDAAAANNGLLVAPSPTL
VLRCREASSGPERDCAPKRSHGSDPLADIHRVLREAGDELERLYQPDFTEMSRQLYLSST
TAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAEWMTEYLNG
PLGSWIQDNGGWDAFVELYDRQRDSVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK
NT seq 894 nt   +upstreamnt  +downstreamnt
atgttcccattacgcacgaaggcgcagaatgggcggcccccactcctgcgcttctctgat
tggataaagaccttggccgtcaagtcaatccgaccaatcagagagcgagctgtgtcacac
ctcccgacgctcttcctaagctccgccccgctgacgctgaggaaagactggcagtcacac
agagctgcaggtgtgtgtggggtgggggcgggagttcagttgcaggaggagaataatgtc
tgccataacctctccaaacgcggctacgcgtgggggttcggtgccgctccggagcagggg
gaggaggacgatgccgccgctgctaataacggcttattggttgcaccctcgccgactttg
gtgctccggtgccgcgaagccagctccgggcccgagcgcgactgcgcccccaagcgaagc
cacggttccgacccgctcgccgatatccaccgggtcctgcgtgaggccggcgacgaactc
gagagactttaccagccggatttcaccgagatgtcccgacagctgtacctctcgtccact
acagctcagaggcggttcgccgaggtgatcgacgaactgttccgggacggcgtcaactgg
ggccggatcatcgccttcttcgagttcggcggcaccgtgtgcgtggagtgcgccactaag
gaggacatgacgtcgcaagtggacaacatagccgagtggatgactgagtacttaaacgga
cccctaggcagctggatccaagacaacgggggctgggatgcttttgtggagctctacgac
cgtcagagggactctgtcttcagctgcacgtggccgtccatcaagacagtcttcggcctg
gccgcgctcggggcggccagcctcaccattggcgcgtacctcacccagaagtga

DBGET integrated database retrieval system