KEGG   Hippocampus comes (tiger tail seahorse): 109521219
Entry
109521219         CDS       T04969                                 

Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109521219
   04218 Cellular senescence
    109521219
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109521219
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109521219
Membrane trafficking [BR:hcq04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    109521219
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109521219
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 109521219
NCBI-ProteinID: XP_019734478
LinkDB
Position
Unknown
AA seq 290 aa
MDPCFRALCVTFVLASFGRGSGALGPVIKCEPCDDGARLSCKPLPKDCAERVREPGCGCC
LTCALSFGQPCGVYTGRCGAGLACQHQPGETRPLQALLEGRGVCANATSTRRLVERPTPP
VNELPETIETPDEEHNSTSGVFQNTHSAHSRPTGPVRPALNPFPPSAKAEILRREQQKRI
KSFKMEDVPGPLLTDQQNFSLEIKPEPEYGPCRRELESILGSLKITDTLNPRGFRIPNCD
KKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGFDGKERGVARHVSSQGQ
NT seq 873 nt   +upstreamnt  +downstreamnt
atggatccgtgcttccgcgccctttgcgtgactttcgtgctggcgtcttttggccgcggg
tcaggtgcgctgggcccggtgatcaagtgcgagccgtgcgacgatggcgcgcgcctgtcc
tgcaaacctctgcccaaggactgcgccgagagggtccgagagccgggctgcggctgctgc
ctgacgtgcgcgctcagcttcggccagccgtgcggcgtgtacacgggcagatgcggcgcc
gggctcgcctgccagcaccaaccaggcgagaccagaccgctgcaggcgcttctggaggga
cgaggggtctgcgccaacgccacgagcactcgacgtctcgtggagagaccgacgcctcct
gtcaatgagctgccagagaccatcgagactccggacgaggagcacaactctaccagtggc
gtcttccagaacacgcacagtgcacatagcagacccacgggacccgtgagacctgcgctt
aaccccttcccgccctctgccaaggctgaaatcctacgacgggagcagcagaagagaatt
aaaagctttaaaatggaggacgtgcctggaccactcctgacagaccaacagaacttctcc
ctggagatcaaaccggagcctgagtatggtccctgtcggcgagagctcgagagcatcctc
ggcagcctcaagattacagacacactcaaccctcgaggtttccgcataccaaactgcgac
aagaagggcttttataagaaaaagcagtgccgtccatccaagggcagaaagcgaggcttc
tgttggtgtgtggacaaatacgggcagcccttgccaggtttcgatgggaaggagcgagga
gtcgcccgacacgtcagctcgcaaggccaatag

KEGG   Hippocampus comes (tiger tail seahorse): 109524696
Entry
109524696         CDS       T04969                                 

Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109524696
   04218 Cellular senescence
    109524696
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109524696
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109524696
Membrane trafficking [BR:hcq04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    109524696
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109524696
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP BatA
Other DBs
NCBI-GeneID: 109524696
NCBI-ProteinID: XP_019740291
UniProt: A0A3Q2XQB9
LinkDB
Position
Unknown
AA seq 357 aa
MWRSLMSGLSVYIIHTGEGVTSWPFAPLYKTRSPRQRNYRWRRPAAWQRHREPTPTASTR
DHRHRHTMPALRVLCLAAALAALARSGGVAAVGPLVRCEPCDSVALLQCKPLPKDCAERL
REPGCGCCVTCALGRGRACGVYTARCGSGLTCQQQPGESRPLQALLEGRGVCASASAGAS
TQKLGAIPVPAQKQDRGRNGVEEGLANKTATMSASPPLSTVKGGQSGGVMDTRPPLHNKL
IRKDQNKKTHSYKVASVSEGANADMQNFSLENKRESEYGPCRREMESILNSLKISNVLNP
RGFRIPNCDRRGFYKKRQCRPSKGRRRGYCWCVDKYGQSLPGYDGGDEKQCHNRESQ
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgtggcggtccctcatgtctggactctccgtttacattattcatacgggggagggagtg
acttcttggccttttgcgccgctgtataaaacgaggagtccgcgtcaaagaaactacaga
tggagaaggcccgccgcctggcagcgtcaccgagagccaaccccgactgcgtccactcgt
gaccatcgccatcggcacaccatgcccgcgctccgcgtgctctgtctggcggccgcgctg
gccgcgctcgcgcgaagcggcggcgtcgccgccgtggggccgctggtccgctgcgagccg
tgcgactccgtggcgctgctgcagtgcaagcccctgcccaaggactgcgccgagcgcctg
cgggagcccggctgcggctgctgcgtgacgtgcgccctgggccgagggcgcgcgtgcgga
gtgtacacggcgcgctgcggctcgggtttgacctgccagcaacagccgggcgagagccga
cccctgcaagctcttttggagggacggggagtgtgcgccagcgccagcgccggcgcgtcg
acccaaaaactcggcgccatcccggttccggcgcaaaaacaagaccgcgggcgaaatggg
gtcgaggaaggcctcgccaacaagacggcgacaatgagcgcgtcgccgcctttgtcgact
gtcaaaggcggtcagagtggaggcgtgatggacaccaggcctccgttacacaacaagctg
ataaggaaagatcagaacaagaagactcacagctacaaggtggcgtcggtgtcagaggga
gccaatgcggacatgcagaacttctccctggagaacaaaagggagtctgagtatggcccg
tgtcgtcgggagatggaaagcatcctaaatagtctgaaaatcagcaacgtgctcaacccg
agaggcttccgcatacccaactgtgacagaagaggcttctataagaaaagacagtgccgt
ccatccaaaggcagaaggcggggatactgctggtgcgtggacaagtacggacagtccctg
cccggctacgacggcggagatgagaaacagtgtcacaaccgcgagagccaatga

DBGET integrated database retrieval system