KEGG   Hippocampus comes (tiger tail seahorse): 109521879Help
Entry
109521879         CDS       T04969                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00010  Glycolysis / Gluconeogenesis
hcq00053  Ascorbate and aldarate metabolism
hcq00071  Fatty acid degradation
hcq00280  Valine, leucine and isoleucine degradation
hcq00310  Lysine degradation
hcq00330  Arginine and proline metabolism
hcq00340  Histidine metabolism
hcq00380  Tryptophan metabolism
hcq00410  beta-Alanine metabolism
hcq00561  Glycerolipid metabolism
hcq00620  Pyruvate metabolism
hcq01100  Metabolic pathways
Module
hcq_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109521879 (aldh2)
   00053 Ascorbate and aldarate metabolism
    109521879 (aldh2)
   00620 Pyruvate metabolism
    109521879 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109521879 (aldh2)
   00561 Glycerolipid metabolism
    109521879 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109521879 (aldh2)
   00310 Lysine degradation
    109521879 (aldh2)
   00330 Arginine and proline metabolism
    109521879 (aldh2)
   00340 Histidine metabolism
    109521879 (aldh2)
   00380 Tryptophan metabolism
    109521879 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109521879 (aldh2)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109521879 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 109521879
NCBI-ProteinID: XP_019735517
UniProt: A0A3Q2X8C3
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MLRAVFSRSLPRVKVVSACHYSAAAIPAPSTQPEIHFNKLFINNQWQDAASGKTFPTVNP
ATGEIICHVAEANEVDVDKAVKAARDAFRLGSPWRRMDASQRGLLLSRLADAIERDSAYL
AELETLDNGKPYAVSYTVDLPTVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVANLIKEVGFPDGVVNILP
GMGPSAGAAIAGHMDVDKVAFTGSTEVGHLIQQASGNSNLKKVTLELGGKSPNIILSDAK
MEEAVEQAHFALFFNQGQCCCAGSRTYVQADIYDEFLERSAERAKKRVVGNPFDLKTEQG
PQVDEEQFNKILGYISSGKKEGAKLMCGGSAAADKGYFIQPTVFGNVQDNMTIAREEIFG
PVMQILKFKTLEEVVERANDSKYGLAAAVFTKDIDKANYIANALRAGTVWINCYDVFGAQ
APFGGYKASGNGRELGEYGLDNYTEVKTVTMKVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctccgagctgtgttttctcgcagccttccacgcgtgaaggttgtatcggcgtgccac
tactccgctgcggctatacctgcacccagcacccaacccgagattcactttaataagctt
ttcatcaataaccagtggcaggacgcagcaagtgggaaaacatttcctactgtaaaccca
gcgacaggggagatcatctgtcatgtggctgaggccaatgaggtggatgtcgacaaggca
gtgaaagcggcacgtgatgccttccggttgggatcgccatggagacggatggatgcctcc
caaagaggcctgcttctcagccggctggcggatgcaattgagagggattccgcctacctt
gctgaactggagacccttgacaatgggaagccatatgctgtttcctacacagtggatctt
cccactgtggtcaaatgtctcaggtactacgcaggctgggctgacaaatgggagggaaag
actatccccattgatggagattatttctgctacaccaggcatgaacccataggagtctgt
ggacaaatcataccgtggaacttccctctcttgatgcaggcgtggaaacttggccccgct
cttgcaaccggtaacactgtggtgatgaaagtcgctgagcagactccgcttaccgctctc
tacgtagccaacctgataaaagaggtggggtttccagacggtgtggtgaatattttgcct
ggcatggggccctcagctggagctgccatagcgggacacatggatgttgacaaagtggcc
ttcacaggatcaactgaggttggtcatctcatccagcaggcttcaggcaacagtaacctg
aagaaggtcactctggagcttggaggaaaaagtcccaacatcatcctgtccgacgcaaaa
atggaagaggccgtggagcaggcgcactttgctttgtttttcaaccaaggccagtgctgt
tgtgctggctcccggacgtacgtccaagccgatatctacgacgagtttttggaacgcagt
gcggaaagagctaagaaacgagtggtgggcaacccctttgacttgaagactgagcaggga
ccccaggttgatgaggagcagttcaacaagattttgggatacatcagcagtgggaaaaaa
gagggagccaaactcatgtgtggaggcagcgcggctgctgacaagggatatttcatccaa
cctacggtgtttggaaacgttcaggacaacatgaccattgccagagaagagatctttggt
ccggtaatgcagatcttaaagttcaagacacttgaggaggtagtcgagagagccaatgat
tctaaatatggtctggctgctgctgtgttcaccaaggacattgataaggccaactacatt
gccaatgcactccgtgctggcacagtctggattaactgttatgacgtgtttggggcccag
gctccgtttggaggatataaggcttcaggaaatggcagagagttgggagaatacggcctg
gacaactacactgaagtcaaaacggtgaccatgaaagtaccacagaagaattcgtaa

DBGET integrated database retrieval system