KEGG   Hippocampus comes (tiger tail seahorse): 109521893
Entry
109521893         CDS       T04969                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00230  Purine metabolism
hcq01100  Metabolic pathways
hcq04020  Calcium signaling pathway
hcq04114  Oocyte meiosis
hcq04261  Adrenergic signaling in cardiomyocytes
hcq04270  Vascular smooth muscle contraction
hcq04371  Apelin signaling pathway
hcq04540  Gap junction
hcq04912  GnRH signaling pathway
hcq04914  Progesterone-mediated oocyte maturation
hcq04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109521893 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109521893 (adcy3)
   04020 Calcium signaling pathway
    109521893 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109521893 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109521893 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109521893 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    109521893 (adcy3)
   04916 Melanogenesis
    109521893 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109521893 (adcy3)
   04270 Vascular smooth muscle contraction
    109521893 (adcy3)
Enzymes [BR:hcq01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109521893 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4 DUF1053 OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 109521893
NCBI-ProteinID: XP_019735550
LinkDB
Position
Unknown
AA seq 1122 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYIIVMCAVVYTSDKLASVLVASVGLLADIL
LYLLCRFGLLPDRISRRVVPYALWVLIAAQIFCYLGLNYAHFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITTVTCGVHTLVLGVTIAQQQQEEIQGAALGRQLLANIVIYVCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQTTMECLHGEFEVEPGNGGERCD
YLRERGLETYLVVVSKGPVGKNGINSVKLSVTSSNGNSPLLINTTECNGSVNTACTTPEE
PEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALKGKH
TNRLSLRFVDPDLETRYSVEKEKQSGAAFCCSCMVLLFTAAMEALIDPRLIANYITFAVG
EVLLLILTICSMAAIFPRVFPKKLVGFSTWIDHTRWARNTWAMAAIFILTMADIVDMLSC
LPQGPLSVSTSVSSPPSLSSIWSSPEGCLNNPKYYSYIAVLALMATTMLVQVSHMVKLTL
MLLITVATGVVNIYSWRDIFDRYDMARFHDYRSYLVPSKLTMTIMIFTMMVSFYYFSRHV
EKLARTLFLWKLEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYD
EIGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRYITKIKTIGST
YMAASGVTSDVNNGYACTKKEEQSDKERWQHLADLADFALAMKVTLMNINYQSFNNFMLR
IGLNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGFRFV
RRGPIFVKGKGELLTYFLKGRDKQGSFLNGSSVTLPHQVVDS
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgcctcggaatcgagcgttctcagagccggagtactctgctgagtattccgcggactgt
tccgtgactctgccctctgaccctgggcaggcagttgggcgaacacacgaggtcacggtg
aggagctcaggttgctgcctttgcctacctcgtttcatgcgcctcacctttgcgccagag
tccctggagaacctctaccagacctacttcaggcgtcaaagacacgaaaccttactggtg
ctggttgtgttcgcggctctcttcgacagctacatcattgtcatgtgtgcggtggtctac
accagtgacaagctggcatctgtcctggtggcatctgtggggctgctagcagacatcctc
ctctacctgctgtgccgcttcgggctgctgccagatcgcatctccaggcgggtggtgccc
tacgccctgtgggtgctcatagcggctcaaatattctgctacctgggtttgaattatgcc
cactttcaccaggccagcgacacagtaggctggcaggctttcttcagcttctcctttttc
ctgacactgcctttgaggttgactcccatcgtgctcatcacgactgtcacctgcggggtt
cacaccctggttctgggtgtcaccatcgcccagcagcaacaggaggagatccagggagca
gcacttggcagacagctcctggccaacattgtgatctatgtttgtgccatcaccgtgggc
gtcatgtcatactacatggcagaccggaagcacagaaaggcttttcttgaggcaagacaa
tcgctcgaggtcaaactcaacctggaggagcaaagccagcaacaggaacgcctgctgttg
tccatccttcccaaacacatagctgacgagatgctgcaggacatgaaaaaggagcccagt
cagaaagagatgcagcagtttaacaccatgtacatgtacagacatgaaaatgtcagtatt
ttgtttgcagacattgtgggctttacccagctgtcatcatcatgcagcgctcaggagctg
gtcaaactgctcaatgaactctttgctcggtttgacaaacttgctgcaaaatatcaccag
ctgagaatcaagatcctcggagactgttactactgtatttgcgggctgccagactacagg
gaggaccatgccgcctgttccatcatgatgggcctcgccatggttgaggccatctcgtat
gtacgtgagaaaacccaaacagatgttgacatgcgagtgggagtgcacagcggcacagtc
ttggggggagtgctgggtcaaaaacgatggcaatatgacgtgtggtccactgatgtcact
gtagccaacaagatggaggctggagggataccaggtcgtgtccacatctcacaaaccacc
atggagtgtcttcatggggagtttgaagttgagccagggaatggaggtgagcgctgtgac
tacctgagggagagaggactcgagacctacctagtagttgtttccaaaggacccgtggga
aaaaacggcatcaacagtgtaaaattatctgtaacttcatccaatggaaactcccctctg
ctgatcaacaccacagagtgtaatggtagcgtgaacacagcctgcaccacaccagaagaa
cctgaagaactggacaccagggttgtcaacccgtctttcccaaatcctcgccgaaggcta
cggctgcgggatctggctgaaagggtgattgatgcccaagagaacgaacaggagctcaac
aaactgctaaatgaagctctgttggagcgagaaactgtccaagctttgaaggggaagcac
acaaaccgtctctccctgaggtttgttgaccccgacttggagactcgctactcggtagag
aaggagaagcagagtggagctgccttctgctgctcctgcatggttctgctcttcactgct
gccatggaggccctcattgatcctaggttgattgcaaattacatcacttttgcggtgggg
gaagtcctactcctcatcctgacaatctgttcaatggccgccatctttcccagggttttt
cccaagaagcttgttggtttctcaacttggattgaccacactcggtgggctcgtaacacc
tgggccatggcagccatcttcatacttaccatggctgacattgttgacatgctgagttgt
ctacctcaaggtcctttgtcagtcagcacctcggtgtcatccccgccctccttatcctcc
atctggtcgagccctgaaggttgtctgaacaaccccaaatattacagctacattgctgta
ctagcactgatggccaccaccatgctggttcaagttagtcacatggtcaaactcacgctg
atgctgcttatcacagtggctactggtgtcgttaatatatacagctggagggacatcttt
gaccgctatgacatggcccgctttcatgattacaggtcatacttagtgccatccaaattg
accatgacaattatgatcttcactatgatggtcagcttttattatttctcccgacatgtg
gagaagcttgctcgcaccctattcctgtggaagcttgaggttcatgagcaaaaagagaag
gtatatgagatgagacgatggaatgaagcgttggtgaccaacatgcttcctgaacatgtt
gctcgacacttcctgggctccaagaaaagagatgaggagttgtacagtcagtcgtatgat
gagatcggagtcatgtttgcgtccatcccaaacttctccgacttctacacagaggagagc
atcaataatggaggcattgaatgcttacgcttcctcaacgagatcatctcagactttgac
agtttgctggatgagcctcagtttcgctacatcacaaaaatcaagaccatcggaagcacc
tacatggccgcatcaggggttacttctgatgtcaacaatgggtacgcctgtaccaagaag
gaggagcagtccgacaaagagcgctggcagcacctggcagacctggcggactttgcgcta
gccatgaaggtcacactcatgaacataaactaccaatccttcaacaacttcatgctacga
atcggtctgaataaaggagcagttttagcaggtgtgattggtgcccgcaaacctcactac
gacatctggggaaacacagtgaatgttgctagtcgtatggagtccacgggggtgatggga
aacattcaggtggtggaggattgctacaacattctcaaagagtatggcttccgctttgtg
aggagggggcctatctttgtgaagggaaagggggagctgctcacttattttctcaaggga
agggacaaacaaggttcctttctgaatggctcctctgtcactcttccacatcaagttgtg
gacagctaa

DBGET integrated database retrieval system