KEGG   Hippocampus comes (tiger tail seahorse): 109521897Help
Entry
109521897         CDS       T04969                                 

Gene name
cnih4
Definition
(RefSeq) protein cornichon homolog 4
  KO
K20368  protein cornichon
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109521897 (cnih4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hcq02000]
    109521897 (cnih4)
Membrane trafficking [BR:hcq04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    109521897 (cnih4)
Transporters [BR:hcq02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   109521897 (cnih4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon DUF2650
Motif
Other DBs
NCBI-GeneID: 109521897
NCBI-ProteinID: XP_019735554
LinkDB All DBs
Position
Unknown
AA seq 139 aa AA seqDB search
MDAAVFILSLIDCCALIFLAVYFIITLSDLECDYINARACCSKLNKWVIPEMVGQCLSTV
LMLVSTHWFIFFLNLPVAAWDIYRYVKVPMGNMGVFDPTEIHNRGQLKSHMKEAMIKLGY
HLLCFFIYLYSMILALIND
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgccgtgtttattctgtcactgatcgactgttgtgcactgattttcctcgcg
gtctattttattattaccttgtctgatttagaatgtgactacatcaacgccagagcatgc
tgctccaaactcaataaatgggtaataccagagatggttggccagtgtctgtccactgtg
ctgatgctggtctccacacactggttcatcttcttcctcaaccttcccgtagcagcctgg
gacatttatagatacgtgaaggtcccgatggggaacatgggcgtgtttgaccccactgag
atccacaaccgggggcagctcaagtcacacatgaaggaggccatgatcaaactgggatac
cacctgctttgtttcttcatttatttgtacagcatgattctggctctgatcaacgactga

DBGET integrated database retrieval system