KEGG   Hippocampus comes (tiger tail seahorse): 109521931
Entry
109521931         CDS       T04969                                 

Definition
(RefSeq) brain-specific angiogenesis inhibitor 1-like isoform X1
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109521931
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hcq01002]
    109521931
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109521931
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hcq04030]
    109521931
Peptidases and inhibitors [BR:hcq01002]
 Mixed peptidases
  Family P2
   109521931
Membrane trafficking [BR:hcq04131]
 Endocytosis
  Phagocytosis
   Others
    109521931
G protein-coupled receptors [BR:hcq04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   109521931
SSDB
Motif
Pfam: AGRB_N 7tm_2 GAIN TSP_1 TSP1_spondin GPS TSP1_ADAMTS TSP1_CCN
Other DBs
NCBI-GeneID: 109521931
NCBI-ProteinID: XP_019735628
LinkDB
Position
Unknown
AA seq 1535 aa
MSNIASQFASCPLRMVIQYFFPLLLMGAWCHSSPSGSESNSCSTLVQSRFFGFFRSSSVF
PTVPCSWTLQNPDPRHYTIFIKITKPTQDCLPLQLRIFQYDTFLETTHSYLGIDSFDEVV
RLCDTSAPMAFLEADKQFVHMRKGPHQKDATTTSDSDEFKVEYLVVGKRNPSMAACQMLC
QWLEDCLASSTSSRPCGIMQMPCSCWHPPPKHGEGNSCYYNGVYLENCLPKVRETGKNTK
INGKDLHISRSQSLRSVDSRKQLDDGDKQHSGQQNPQTDSTSGEEWSAWSVCSATCGEGW
QSRTRFCVSSSYSTQCSGPLQEQRTCNPAVCPVAGAWDEWSPWSLCSSTCGRGYRSRTRT
CTPPQFGGDPCDGPEKQTKFCNIAVCPVDGEWNEWSSWSSCSSSCSNGTTQRTRECNGPS
YGGSECRGEWLETIDCFLGECPVDGRWQPWSLWSGCSKTCGGGRQQRNRICYGPFFGGQS
CPGEREEVRHCNEKRCPEPHEICAEDNYSNVVWKMTPAGDTAAVRCPPNAMGLILRRCIL
DEEGMAYWENPTYMKCISNDYRSIQTLTREHLSKAQRGLVGDGLSEVMTKLRVTSSDGTS
YSGDLQAILDVLKNMTEIFRRAYYSPSSADMRNFVQSLSNLLMEENRMRWEEAQLLGPNI
KELFRLFEDFVDVVGLRMKDFQDMYEVTDNIVLSIHKRPVLSNADISFPMKGWRGMVDWA
RNSEDRVIIPKHILLTAKPDSDDSSTFVTGIILYRNLGSVLNLQRNGTILNSKIVSVTIK
PTPASLSAPVTVEFSHLYNGTTNQTCISWDENESSSLLGSWSARGCKTVLVDALRTKCLC
DRLSTFAILARLHPEMNMDKTQLPSVTLIVGCGVSSLTLLLLIIIYVSVWRYIRSERSVI
LINFCLSIISSNALILIGQTQTRNKVLCTIIAAFLHFFFLSSFCWVLTEAWQSYMAVTGR
LRNRIIRKRFLCLGWGLPALVVAISVGFTKAKGYGTPSYCWLSLEGGLLYAFVGPAAAVV
LVNMVIGILVFNKLVSKDGITDMKLKERAGQMTVPLYNMTLKCAKCGVISSADVSATATS
NAMASLWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSMEGFVIVMVHCILRRE
VQEAVKCRVGDRQEDGNGDSGGSFQNGHAQLVTDFEKDVDMACRSGTMKHSSLQGEEKPT
SGAVTLQRGSNFNTMPASMAKVHLQNMADYTSHTLTLRREKCTTKGISTELPGAKSIYIC
DSELFKQLDGDLPQRNGEGSSCEGTSKAAGLVLLPANNTATLRPAKGKEEQPTKYNISVE
QLPQTRLIHLANPVSGEPVLGFGLKSLPADQVSVSCSERDSPAHNLQNLPRDSQVDSSTC
NGAESGNSVVMTKSETVSTLSTSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKIHS
ADMDVDSSPVDAKATKRWSVSSAGSDKTNISDKQQTPSKRMWEGIQKTHSPPSWGRKDLA
TAVTSPLEMQTVEWEKTSATIPLVGQDIMDLQTEV
NT seq 4608 nt   +upstreamnt  +downstreamnt
atgtcgaacattgcttctcaatttgccagttgcccgcttcgaatggtgattcagtatttt
tttcctctgctattaatgggggcgtggtgccactcatccccttcagggtccgagtcaaac
tcctgttctacactggtccaaagccgcttttttggcttctttcggtcatcatcagtattc
cccactgtgccttgctcctggaccctgcagaatcctgatccacggcattacaccatcttc
atcaagataacaaaacctacccaggactgtctgccattacagcttcgtatcttccaatac
gacactttcttggagaccacacactcctacctaggaattgacagctttgacgaagttgtg
aggctgtgtgacacctccgccccaatggccttcctggaggctgacaagcaatttgttcac
atgagaaagggtcctcatcagaaagatgcaaccactacaagtgacagtgacgagttcaaa
gtcgagtacctggttgttggaaaacgtaaccccagcatggcagcctgtcagatgctttgc
cagtggctggaggactgtttggcttccagcacatcaagcaggccatgtggcattatgcag
atgccgtgttcgtgctggcatccgccgccaaagcacggtgagggcaacagctgttactac
aacggagtttacctggaaaactgtttacccaaagtaagagaaactggaaaaaacaccaaa
ataaatggtaaagacctgcacatttctcgaagtcagtcacttcgttcagtggacagtcgt
aagcagcttgatgatggagacaagcaacacagtggacagcaaaaccctcagacagactca
acctcaggtgaggagtggtcagcatggagtgtgtgttctgctacatgtggggagggctgg
cagagtcgcactcgtttctgtgtctcctcctcgtacagtacccagtgtagtgggccactg
caggagcagagaacttgcaaccctgctgtttgtccagtggccggtgcttgggatgaatgg
tcaccatggagtttatgttcgtcaacatgtggcagaggttatagatcccgaacacgaacc
tgcacccctccccagtttggaggagatccctgtgatggtccagagaaacagactaaattc
tgtaatatagctgtctgtccagtggatggcgaatggaatgagtggtcaagttggagttcc
tgctcatcttcctgctctaatgggaccacacaacgaacaagagagtgtaatggcccctca
tacggaggttctgaatgtagaggagagtggttggagaccattgactgcttccttggggaa
tgccctgtggatgggaggtggcagccatggtctttatggtcagggtgttccaagacttgt
ggcggtggtagacagcagagaaacagaatttgttatgggcccttttttgggggacaatct
tgccctggagaacgagaagaggtccgacactgtaatgaaaaaagatgcccggagcctcat
gaaatatgtgctgaggacaactattcaaacgttgtttggaagatgactcctgctggagat
acagcagcagtacgatgtcctcccaatgcaatgggtttgattttgcgtcgctgcatcctt
gatgaggagggtatggcatactgggagaatccaacctatatgaagtgcatttccaatgat
tatcgcagcatacaaactttgactcgagaacatttatccaaagcacagcgaggccttgtg
ggtgatggactctctgaagtgatgactaaactgagggtgacttccagtgatggcaccagc
tacagtggtgatttgcaggccattttggatgtgctgaagaacatgactgagatcttcagg
agggcatactacagtcccagcagtgcagacatgaggaactttgtccagtcacttagtaat
ctactaatggaagaaaaccgaatgcgatgggaagaagctcaactgctgggtccaaacatc
aaagagctgttccgcctgtttgaggactttgtggatgtcgtcggtctgagaatgaaagac
tttcaggacatgtatgaagtgactgacaacatagttttaagcatccacaagcgtcctgtg
ctgagtaatgcagatatcagcttcccgatgaagggttggagaggcatggtggattgggct
cgcaactcagaggacagagtcatcatcccaaaacacatcctgctaacagccaagccagat
tcagatgactcctcgacatttgtgacaggtatcattctgtacagaaacttgggaagcgtt
ctgaatttgcaaagaaacggcactatactcaactccaagattgtatccgtcaccattaaa
cccactcctgcttccctttctgctcccgttacagttgaattctctcacttgtacaacggc
accacgaaccagacatgtatatcctgggatgagaatgaaagctcctctctgctgggatcc
tggtctgctaggggctgcaaaaccgtgctcgtcgatgcactcagaaccaaatgcctgtgt
gacagactgtccaccttcgccattttagcacgacttcaccccgaaatgaacatggataag
acacagctcccatccgtgacactgattgtgggatgtggagtgtcttctctgacattgttg
ctactcatcatcatctacgtgtcggtctggagatatattcggtctgaaagatcagtcatt
cttatcaacttctgcctctcaatcatttcttccaatgcccttattctcattggacagacc
caaacaagaaataaggtcttatgtaccataatagcggcgtttcttcacttttttttcctg
tcatcattctgttgggtcctgacggaggcatggcagtcatacatggcagtgacgggtcgt
ctaaggaatcgcataatacgcaagcgttttctctgtcttggctggggactccccgccctt
gttgttgcaatctcagtgggctttaccaaggcaaaaggctatggaacaccgagctactgc
tggttgtctctggaaggaggtcttctctatgcatttgttggaccagctgctgctgttgtc
ttggttaacatggttattgggattctcgtatttaacaaactggtgtccaaagacggcatt
actgatatgaaactaaaggagagggcgggtcagatgacagtgccactgtacaatatgacg
ctcaaatgtgccaagtgtggagttatctcgtcggctgacgtttccgccacagctaccagt
aacgccatggcctcactgtggagctcctgcgtggttttgccccttctggctctcacatgg
atgtcagctgtacttgccatcactgaccggcgctctgcactattccagattctatttgct
gtctttgattctatggaaggctttgtcattgtaatggtgcattgcatcctacgaagagag
gttcaggaagcagtaaagtgccgcgtgggagaccgccaggaagatggtaatggggattct
ggtggatctttccagaatggacatgctcagcttgtgactgactttgagaaggatgttgat
atggcttgcagatcaggcactatgaagcactcctccctccagggtgaggaaaagcccact
tctggggctgtaacccttcaaaggggatctaacttcaatacaatgccagccagtatggcc
aaggtccatctccagaacatggcagactataccagccacacactgactctacgcagagag
aaatgtaccactaaaggaatcagcactgagttgccaggtgccaaatccatttacatatgt
gacagtgagctctttaagcagctagatggtgaccttccacaaaggaatggagaaggaagc
agttgtgagggcactagcaaagccgcagggctagtcctattaccagccaacaacacagct
accctaaggccagccaagggcaaagaagagcaaccaaccaagtacaacattagtgttgag
cagctgcctcagacaaggctcatccacctggctaaccctgtcagtggtgagccagtgctt
ggattcggactgaagagcttgcctgctgaccaggtcagtgtgtcatgttcagagagagac
tcacctgcgcacaaccttcaaaacctgccaagagactctcaagtggacagcagcacctgt
aatggagcagaatctggaaactctgttgtgatgaccaagagtgaaactgtttctacacta
tccacaagctccctggagaggcgaaaatcacgctatgcagagcttgactttgagaagata
atgcacacccggaaacgccaccaggacatgtttcaggacctgaacaggaagattcacagt
gcagacatggatgtagactcttcacctgttgatgccaaagctactaaaagatggagcgtg
tcctctgccggcagcgacaagaccaacataagtgataagcagcagactccaagtaagagg
atgtgggagggcatccaaaagacccactcacctccatcttggggaagaaaagacctggca
acagcagtgacctcccctttggagatgcagacggtggagtgggagaagacaagtgcaact
attcctttggtaggccaggatatcatggacctgcaaacggaggtgtga

DBGET integrated database retrieval system