KEGG   Hippocampus comes (tiger tail seahorse): 109522058Help
Entry
109522058         CDS       T04969                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease serine 9 isoform X1
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hcq01002]
    109522058 (tmprss9)
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109522058 (tmprss9)
Peptidases [BR:hcq01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109522058 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Ldl_recept_a DUF1986 SEA
Motif
Other DBs
NCBI-GeneID: 109522058
NCBI-ProteinID: XP_019735845
LinkDB All DBs
Position
Unknown
AA seq 851 aa AA seqDB search
MSCGHGLREQAAQCCKSNKEMTNDGGGTWSTPGPSPAPSSPTCYRGTLIFGLLFFLGAGV
FVGLLIGDGFLQSRHQILYIDIILQYFSHISCPLCVHVNAAYLIQEQHDFMETVELKGLK
HDPSLQDPNSGFSLVLTSVLKSKIKNVFASSSISHHYVDCNIIAFGNMNGDVMATFRLVF
AVSKFQQYSENFIQDLLRAGLTSVMHGNPLEVPQFGHINAIVLLGASGKSFYNIGDDTLG
EESCPESAFTCDNGECITKLNPECDFVSDCADGSDEARCACGTRSATGNRIVGGEDARQG
ELPWQVSLRLHGQHTCGASIINERWLVSAAHCFETANNPKEWTALVGASLVSGEESESKT
INIKTLAVSPDYNPTTTDVDVAVLELESPLTFGPYVQPACLPAPSHVFAPGQKCVVSGWG
SLHQFSSEMPSTLQKALVKIIDSKVCSKLPVYRGSITSNMMCAGFLQGKVDSCQGDSGGP
LVCEGAPGRFFLAGVVSWGIGCAQIYRPGVYSRVTKLRSWILSHVDPSSKHYYPNHELIL
PVTAPGASASNFPFPKTVAMDVESAPAPPVSNCSGNFQCSATSCINKLNPECDGVPDCPN
QADERNCDCGVRPALGGNRIVGGVTARRGEWPWIGSLQFQRLHHCGATLVHSKWLLTAAH
CFKSDPSPTHWAVSLGSVLRSGVGAVVIPIQRVVIHPAFNGTSMDHDVALLELLIPAPMS
HTIQSVCLPSPAHRFLEDAECYISGWGSMREGGSLTNLLQKAPVSTIEQADCRQSYGDNL
TPHMMCAGYMEGGRDTCLGDSGGPLTCREGSGQWFVAGVTSWGHGCGRVGFPGIYTRVTS
VRNWISSYLPF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtggtcatggactgagggagcaagcggcccagtgttgtaaatccaacaaggag
atgacgaatgatggaggaggcacgtggtccactccgggaccctcacccgctccctccagc
cccacctgctacaggggcactctcatattcggcctcctcttcttcctcggagctggagtc
tttgtaggactgcttatcggtgatggttttcttcaatcccgacatcaaatactgtacata
gatatcattttgcaatatttttcgcacatttcttgtcctctctgtgtgcatgtgaatgca
gcgtacctgatacaggagcagcatgacttcatggagacagttgagctgaagggtctcaag
catgatccgtctctacaggatccaaactcgggcttctccttagtactgacatctgtacta
aaatcaaagatcaaaaatgttttcgcttcctcatccatatcgcatcactacgtcgactgt
aatattattgcttttggcaacatgaatggtgatgtgatggcaacattcaggctggtcttc
gcggtttccaaatttcaacagtattcggaaaacttcattcaggacctgctgagggcgggg
ctcacctcggtgatgcacggcaatccgctggaggttccccagtttggacacatcaatgct
atcgtcttactgggtgccagtgggaagtcattttacaatattggagatgatacgctgggt
gaggagagttgccccgagagcgcctttacctgtgacaacggcgaatgcatcaccaaatta
aaccccgagtgtgactttgtatcagactgtgcagatggatctgatgaagctcgttgtgcc
tgtggcacacgtagcgccacggggaatcgtatcgtgggcggtgaagatgcccgacaagga
gagctgccgtggcaggtcagtctcaggctgcatgggcagcacacttgtggagcctccatt
atcaacgaaaggtggctggtcagtgccgcgcactgctttgaaaccgccaacaaccccaaa
gagtggacagccctggtgggggccagtttggtgagcggggaagagtctgagtccaaaaca
atcaacatcaaaacactggcagtgtctccagactacaaccccacgaccaccgacgttgat
gtggccgtgctggagctggagagtcctctcaccttcggtccctacgtccaacctgcctgt
ctccctgcaccatctcacgtctttgctcccggccagaaatgcgtggtgtcaggatgggga
tctctgcaccagtttagttctgagatgccttccacactgcaaaaggccttggtgaaaatc
atcgactccaaggtgtgcagtaaactgcctgtatacagaggctcaatcacttccaacatg
atgtgtgctggattcctgcagggcaaggtggactcctgtcagggtgattccgggggccct
ttggtgtgcgagggggctccagggaggttcttcctggcaggggtggtaagttggggcata
ggctgtgcccagatctacaggcctggtgtttactcgcgggtcaccaagctccgcagctgg
attctgagtcacgtagaccccagctcgaagcattactaccccaaccatgagctcattttg
ccggtcaccgctccaggcgcgagtgcttctaattttccatttcccaagacagtcgccatg
gatgtcgaatctgccccagcacctcctgtctcaaactgcagtggaaacttccagtgcagc
gccacctcctgtatcaacaagttaaatccagaatgtgacggagtccctgactgccccaac
caggctgacgaaagaaattgcgactgcggtgtgcgtcccgcgttgggcggcaatcggatt
gtgggtggtgtcacggctcgcaggggggaatggccttggatcggcagccttcaattccag
aggctccaccattgtggcgccactctcgtgcacagcaaatggttactgactgccgcgcac
tgcttcaaaagtgatcccagccccacccactgggcagtgagcctcggctctgtactgcgt
tccggtgtgggagccgtggtcattcccatccagcgggtcgtcatccacccagctttcaac
ggcaccagcatggaccacgatgtggcgctgctggagctgctcatcccggcccccatgtct
cacaccatccaatccgtctgtctcccgtcaccagcacaccgcttcttggaagacgctgag
tgctacatctcaggatggggatccatgagggaaggcggttcactgaccaacctgctgcaa
aaagcaccggtgagcaccattgagcaggcggactgccggcagtcatacggagacaacttg
actcctcacatgatgtgtgcgggttacatggaaggaggcagggacacttgtttgggagac
tctgggggtcctctgacttgtcgtgagggctccggccagtggtttgtcgccggggtaacc
agctggggacatggatgcggccgagtagggtttccggggatttacactcgagtgacttcg
gtacggaattggatatcgtcatacctgcctttctga

DBGET integrated database retrieval system