KEGG   Hippocampus comes (tiger tail seahorse): 109522068Help
Entry
109522068         CDS       T04969                                 

Gene name
aldh7a1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00010  Glycolysis / Gluconeogenesis
hcq00053  Ascorbate and aldarate metabolism
hcq00071  Fatty acid degradation
hcq00260  Glycine, serine and threonine metabolism
hcq00280  Valine, leucine and isoleucine degradation
hcq00310  Lysine degradation
hcq00330  Arginine and proline metabolism
hcq00340  Histidine metabolism
hcq00380  Tryptophan metabolism
hcq00410  beta-Alanine metabolism
hcq00561  Glycerolipid metabolism
hcq00620  Pyruvate metabolism
hcq01100  Metabolic pathways
Module
hcq_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
hcq_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109522068 (aldh7a1)
   00053 Ascorbate and aldarate metabolism
    109522068 (aldh7a1)
   00620 Pyruvate metabolism
    109522068 (aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109522068 (aldh7a1)
   00561 Glycerolipid metabolism
    109522068 (aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109522068 (aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    109522068 (aldh7a1)
   00310 Lysine degradation
    109522068 (aldh7a1)
   00330 Arginine and proline metabolism
    109522068 (aldh7a1)
   00340 Histidine metabolism
    109522068 (aldh7a1)
   00380 Tryptophan metabolism
    109522068 (aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109522068 (aldh7a1)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109522068 (aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     109522068 (aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     109522068 (aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 109522068
NCBI-ProteinID: XP_019735897
LinkDB All DBs
Position
Unknown
AA seq 540 aa AA seqDB search
MQRWLNLTIARHSRLLLKNKFPSLHQSAAMSSLLISQPKYAWLKELGLSEDNPGVYNGNW
GGSGEVITSYCPANNEPIARVTQATMVEYEETVQKTKEAWKMWADIPAPKRGEIVRQIGD
GLRKKIKALGSLVSLEMGKIYVEGVGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGHALI
EQWNPVGLVGVITAFNFPVAVYGWNNALALTCGNVCLWKGAPTTPLTSVAVTKIVADVLE
QNNLPGAICSMTCGGADIGTAMAKDERVDLLSFTGSTNVGKMVGMMVQERFGRKLLELGG
NNAIIVFEDADLNLVVPSAVFASVGTAGQRCTTTRRLMLHESVHDAVIERVAKAYKQVRI
GDPWDPSTLYGPLHTKQAVEQYLSAIEKAKQQGGTVVCGGKVMDRPGNYVEPTIITGLAH
DSAIVHTETFVPILYVLKFKTEEEAFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCG
IVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQGIKFE
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgttggctcaacttgaccattgcccgacacagcaggctcctcttgaagaataaa
ttcccatctcttcaccagtcagcagccatgtcaagtcttctcattagtcaacctaaatat
gcttggctgaaggagctgggtctctctgaggacaaccccggtgtttacaatggcaactgg
ggcggcagcggggaggttatcacttcatactgccccgccaacaatgagccgattgccaga
gtaacccaagctacgatggtggagtatgaagagactgtccagaagacaaaggaagcttgg
aaaatgtgggctgatattcctgctccaaaaagaggggagattgtgcggcagattggagat
ggactgagaaagaaaatcaaagcactcgggagcttggtgtctttagagatgggaaagatc
tatgttgaaggggtgggagaagttcaggaatatgttgatgtgtgtgattacgctgtcggt
ctgtcaagaatgattggtgggcccgtcttgccttcagaaagaccaggccatgccctgatc
gaacagtggaacccagttggtctagttggtgtcatcactgctttcaactttcctgtggcc
gtctatggctggaacaacgccctcgctcttacgtgtggcaatgtttgcctttggaaagga
gcaccgaccacacctcttacaagtgtagctgttacaaagattgtagctgatgtgcttgag
cagaacaatctgccgggtgctatctgctccatgacctgtggaggtgctgatattggtacg
gccatggccaaagacgagcgggtggatctcttgtcttttactggcagcactaatgttggc
aagatggtgggcatgatggtccaagaacggttcggccgcaagctgctggaactcggcggg
aacaacgccatcatcgtgtttgaggatgccgatcttaatctggtggtgccctctgcggtg
ttcgcatctgttggaaccgctggccagcgctgcacgaccacaagaaggttaatgctgcat
gagagcgtccacgatgcagtgattgagagggtcgccaaggcctataagcaggtccgcatt
ggagatccctgggatcccagcactctgtatgggcctctgcacaccaaacaagcggtggag
cagtatctgtccgcaattgagaaggccaagcagcaaggcggcactgttgtctgtggagga
aaagtaatggaccgtcctggaaactatgtggagcccaccatcatcaccgggctggctcat
gactctgcgatcgtccacacagaaacctttgtccccattctctacgtcctcaagttcaaa
accgaagaggaggcatttgcatggaacaacgaggtgaagcagggcctgtccagcagcatc
tttaccaaagatctcgggcggattttccgctggctcggacctaaagggtccgactgtggc
atagtgaatgtcaatattccaacaagcggtgctgaaatcggaggggccttcggtggggag
aagcacacaggaggaggcagagagtctggaagtgactcctggaagcagtacatgaggcgc
tcaacctgcaccatcaactacagcaaggatcttcctcttgcacagggaatcaaatttgag
tga

DBGET integrated database retrieval system