KEGG   Hippocampus comes (tiger tail seahorse): 109522206Help
Entry
109522206         CDS       T04969                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04012  ErbB signaling pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109522206
   04068 FoxO signaling pathway
    109522206
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109522206
   04115 p53 signaling pathway
    109522206
   04218 Cellular senescence
    109522206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 109522206
NCBI-ProteinID: XP_019736105
LinkDB All DBs
Position
Unknown
AA seq 168 aa AA seqDB search
MCRMMANVKWILSPLGKGPTRRNLFGPVDKVQLRADYQAALRKDLDEASRRWGFDFMSDQ
PLVSGDFQWEGVPGAKVPLLYRSCVLGKATSQRATQVTVSPKRVKAAPAKNENEKENVPE
NNSERCPVNLERTPRKKENGGLKRKQTNITDFYHPKRRFVDMRIKSGE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagaatgatggcaaacgtcaaatggatcctgagtcctctgggaaaaggccccaca
cggcgtaacctgttcggcccagttgacaaggtgcagctgcgggcagattaccaggccgcc
ctgaggaaagacctggacgaggcatcccggcgctggggtttcgacttcatgtctgaccaa
cctctggttagcggcgatttccagtgggagggcgttcccggcgctaaggtgccgctgctc
tacagatcctgtgtgctgggcaaggcaacgagtcaaagggcaacgcaggtgacggttagc
cccaagagggtcaaggcggcgccggcaaagaacgagaacgagaaggagaatgtccctgaa
aacaactctgagagatgtcctgtcaatctggagagaactccaaggaagaaggagaatgga
ggactcaagaggaaacaaactaatattacagacttctatcaccccaagagaagattcgtc
gatatgcgtattaaatcgggcgagtga

DBGET integrated database retrieval system