KEGG   Hippocampus comes (tiger tail seahorse): 109522286
Entry
109522286         CDS       T04969                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Other DBs
NCBI-GeneID: 109522286
NCBI-ProteinID: XP_019736260
LinkDB
Position
Unknown
AA seq 348 aa
MSKCELIELKDLSVHDPIELAAPGPRAAPSQASHFHIVRLVGDTVSIEAPSGDVGAGHDF
QPYGHTHLSWCDLCGEFIWGLYKQALRCTNCSYTCHQRCRPFIQLDCSADRGLPAGQMDP
SVDSIEMDTNVDEQTDWRKQELSVGEVHQKVKEYNAQINSNLYMVVNKDGSYTGFIKVHF
QLVRPITLPPPRSPTQEEHEYSRRLTRRTSFYLPKDTAKHLHISSKTRVREVIEALLNKF
TVVDNPAKFALFERADRQNHVSMRKLSDDEYPLYLRLCAGPSEKVLSLVLKENETGDVNW
DAFSFPELCNFLRILQREEEEHVRQIVRRYARTRDMMKQAMARITAPA
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagctgattgagctgaaggatctcagtgtacatgatcccatcgagctg
gcggcccctgggccgcgcgccgctccaagtcaagccagtcacttccacatcgtccgtcta
gttggggacaccgtcagcatcgaggcgccatccggagatgtcggcgcgggtcacgacttc
cagccctacggtcacactcacctctcctggtgtgacctgtgtggagaattcatctggggt
ctgtataagcaggcgttacgctgcactaattgcagctacacttgtcaccagagatgtcga
ccgttcatccagctggactgcagtgcagacagaggtttgccagcagggcaaatggatccc
tcagttgactccatcgagatggacacaaatgtggatgagcagactgactggcgcaaacag
gagttaagtgttggcgaagttcatcagaaggtcaaggagtacaatgctcagattaacagc
aatctctacatggtggtgaataaagatggctcctacactggtttcattaaagtccacttt
caactagtccgtcccatcaccctgccacctccccggagccccacccaggaagagcacgag
tacagccggcggctgacgcgacggacatcgttctatctccccaaagacactgcaaagcac
ctgcacataagctccaaaacacgggtacgagaagtcatcgaggccttgctcaataaattc
acagttgtggacaatccagccaagtttgccctgtttgaacgcgccgacagacaaaaccat
gtgtccatgcggaaactgagcgacgacgagtatcccctctatttgcgcttgtgtgcagga
ccaagtgaaaaggtcttgagcctggtcctcaaagagaatgagaccggcgacgtgaactgg
gatgccttcagttttccagagttgtgcaacttcctacgtatactacagcgtgaggaagaa
gaacatgtccggcagatagtgaggcgctacgctcgcaccagggacatgatgaagcaggcc
atggcgaggattactgctcctgcttga

DBGET integrated database retrieval system