KEGG   Hippocampus comes (tiger tail seahorse): 109522391Help
Entry
109522391         CDS       T04969                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00020  Citrate cycle (TCA cycle)
hcq00190  Oxidative phosphorylation
hcq01100  Metabolic pathways
hcq01200  Carbon metabolism
Module
hcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hcq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hcq_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109522391
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109522391
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109522391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 109522391
NCBI-ProteinID: XP_019736479
LinkDB All DBs
Position
Unknown
AA seq 283 aa AA seqDB search
MSVATLTSLNRCGVLALRSSAGLEAVRYAQTAAAPAAQPRIKKFQVYRWDPDTPGDKPRM
QTFDIDLNTCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACLNRID
TNLSKATKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESQEGKEQYTQSVEDRQ
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLSKLQDPF
SLYRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKEKKAAAV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtagctactcttacgtccttgaaccgctgtggtgtgttggcgttgcgctcctca
gctggtttagaggcagtgcgttatgcgcagacagcagctgctccagcagcacagccccga
attaagaagttccaggtgtacagatgggacccagacactccaggagacaagcctcgcatg
cagaccttcgacatcgacctgaacacatgtggcccaatggtacttgacgccctaatcaag
ataaaaaatgaaatggactccacgctgactttccgtcgctcctgcagagaaggtatctgt
ggctcgtgcgcaatgaacatcaacggtggaaacacactggcctgcctcaacaggattgac
actaacctcagcaaagcaaccaagatttaccccctgccacatatgtatgtggtcaaagac
ctggtacctgacatgagcaacttctacgctcagtacaagtccattgagccctacctgaag
aagaaggatgagtcccaggaggggaaagagcagtacacacagtctgtggaggatagacag
aaactggacgggctatacgagtgtatcctttgcgcctgctgcagcacctcctgccccagc
tactggtggaatggagacaaatacctcggacctgccgtgctcatgcaggcgtatcgctgg
atgatcgactcgcgggacgacttcacagaggagcgtctgtccaagctgcaagatcccttc
tctctctaccgctgccacaccatcatgaactgcaccaagacgtgccccaagggcttgaac
ccggggaaagccatagcggagatcaagaagatgatggccacctataaagagaagaaagca
gctgcggtttga

DBGET integrated database retrieval system