KEGG   Hippocampus comes (tiger tail seahorse): 109522438
Entry
109522438         CDS       T04969                                 

Gene name
cdk2
Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04114  Oocyte meiosis
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
hcq04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109522438 (cdk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109522438 (cdk2)
   04114 Oocyte meiosis
    109522438 (cdk2)
   04115 p53 signaling pathway
    109522438 (cdk2)
   04218 Cellular senescence
    109522438 (cdk2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109522438 (cdk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109522438 (cdk2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hcq03032]
    109522438 (cdk2)
   03036 Chromosome and associated proteins [BR:hcq03036]
    109522438 (cdk2)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109522438 (cdk2)
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109522438 (cdk2)
DNA replication proteins [BR:hcq03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109522438 (cdk2)
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109522438 (cdk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 109522438
NCBI-ProteinID: XP_019736569
UniProt: A0A3Q2YE02
LinkDB
Position
Unknown
AA seq 298 aa
MDSFQKVEKIGEGTYGVVYKAKNKNTGETVALKKIRLDTETEGVPSTAIREISLLKELSH
PNIVKLHDVIHTENKLYLVFEFLNQDLKKFMDSSTVTGIPLALIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKFY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEATWPGVTSMPDYKPSF
PNWARQDLSKVVPLLDEDGRDLLREMLRYDPNKRLSAKNALVHRFFRDVTMPLPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggattcctttcagaaggtcgaaaagataggagagggcacatatggagtggtgtacaaa
gccaagaacaagaacacgggtgaaacggtggcgctcaagaagataaggctggacacggaa
actgagggtgttccaagcactgccatccgggaaatttccctcctcaaagagctcagtcac
ccgaatattgtcaagttgcacgatgtcatccatacggagaacaagctttaccttgtcttt
gagttcctcaaccaggatctcaagaagtttatggattcttccacagtcactggtatcccg
ctcgctctgattaagagttatctcttccagctgctgcaaggcttggcattctgccactcc
cacagggttctccatcgcgaccttaagcctcagaaccttctcatcaacgctcagggtgag
atcaagctggctgacttcggcctggcgagagcattcggggtgcctgtgcgtacatacaca
catgaggtggtaaccttgtggtacagagcacctgagatcctgctgggctgcaagttttac
tccaccgctgtcgacatctggagtctgggttgcatcttcgcggaaatggtcacacggagg
gcactcttccccggcgactctgagatagaccagctcttccgcatcttccgcaccctcggc
acccctgatgaggccacgtggccgggagtcacttccatgcccgactacaaaccgtcgttc
cccaactgggcccgccaggatttatccaaagtggttcctctcctggatgaggatggaaga
gatcttctccgagaaatgctgcgctacgatccaaacaaaaggctatcggccaagaacgca
cttgtccatcgcttcttccgtgacgtcaccatgccgcttcctcatctgagactctga

DBGET integrated database retrieval system