KEGG   Hippocampus comes (tiger tail seahorse): 109522483
Entry
109522483         CDS       T04969                                 

Gene name
mdm4
Definition
(RefSeq) protein Mdm4
  KO
K10127  protein Mdm4
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109522483 (mdm4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hcq04121]
    109522483 (mdm4)
Ubiquitin system [BR:hcq04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    109522483 (mdm4)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP
Other DBs
NCBI-GeneID: 109522483
NCBI-ProteinID: XP_019736653
LinkDB
Position
Unknown
AA seq 487 aa
MSSLSAQASASGTPCRALPGEGNQVQPKAPLLQILRIAGAQEDVFTLKEVMHYLGQYILG
KQLYDKQRQHIVHCQDDPLGELLEVESFSVKNPSPVYEMLKKYVVILDSADAAENLSVGR
ECVEGGVEDRGQIFGGVVKAGLEAASDRPPLPTCSQRRPREPDDDSLEGLPRSACKRPKL
DVTLDDWDLSGLPWWFLGNLRSNYSRRSNGSTDIHTNQEEDTAIVSDTTDDLWFLTEGES
EQVSVEMKEAALEERSAGEGDAPLDEEDGGGKEEKTDREMQEEPDEDSQCLSDDTDTEIS
TQDAWQCSECRKYNSPLQRYCVRCWALRRNWYKDVPRLAHSLSVPDIPAFGSLSAHHEDD
DSDAGIDVPDCSRTVSDPVILPSHSTADRPLPPAPASRRHAGPKDGQASGGESQESLGME
VEVECQPEALLEPCKLCRVRPRNGNIIHGRTAHLLTCFPCARRLHKFQAPCPGCGQIIQK
VVKIFVV
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgagctccctatcggcccaggcttccgcctctggcacaccatgcagggcactgcctgga
gaaggaaatcaggttcaacccaaagctcccctcttgcaaatactgcgcattgctggagcc
caggaggacgtcttcacacttaaagaggtaatgcactacttgggccagtacattttggga
aagcagctctacgataaacaaaggcagcacattgtccattgccaggatgacccattggga
gagctgctggaagtggagagcttctctgtgaagaacccaagcccggtgtatgaaatgctc
aagaaatatgtcgtcatactcgatagtgctgacgctgcagagaatctttctgtgggccgt
gagtgtgttgagggcggagtggaagatcgtggtcagatttttgggggtgtggtcaaagcg
ggactggaggctgccagtgacaggcctcccctgccgacctgttcccagagaagacctcga
gagcctgatgacgactcccttgaaggtttgccacgctctgcctgcaaacgacccaaatta
gatgtcactcttgatgactgggacctctctggcttgccctggtggtttttgggcaatctc
cgcagtaactacagccgcaggagcaacgggtccactgatattcacaccaaccaagaggag
gacacggccatcgtgtcggacaccacggacgacctgtggttcttgacggagggcgaaagt
gagcaagtgagcgtggagatgaaggaggctgcgctggaagagagaagcgccggcgaagga
gatgcgccgctcgatgaggaggatggagggggaaaggaggagaagacggatcgagagatg
caggaggagccagacgaagattctcagtgtctcagtgatgacacagacaccgagatctcc
acacaggatgcgtggcaatgcagcgaatgcaggaagtacaactctcctctgcagcggtat
tgcgtccgctgctgggccctgcgtaggaactggtacaaagacgtgccccgactcgcccac
tccctctccgtccccgacatcccggcgttcggctccctgagcgcgcaccacgaggacgac
gacagcgacgcgggcatcgacgtccccgactgcagccgcaccgtttctgacccggtcatc
ctgccctcccactccaccgccgaccggccgctgccacccgcccccgcgtcccgacgccac
gccggccccaaggacgggcaggcgtcgggcggggagagtcaggagagtctgggcatggag
gttgaggttgaatgccaaccggaggccttgctggagccgtgcaagctgtgtcgggttcga
ccccgcaatggcaacataatccacggacgcacggcccatctcctcacctgcttcccgtgt
gccaggaggctccacaaattccaggctccttgcccgggatgtggacagattatccagaaa
gttgtaaagatattcgttgtgtag

DBGET integrated database retrieval system