KEGG   Hippocampus comes (tiger tail seahorse): 109522562
Entry
109522562         CDS       T04969                                 

Definition
(RefSeq) protein shisa-5-like
  KO
K10135  scotin
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109522562
SSDB
Motif
Pfam: Shisa Comm EphA2_TM ETRAMP
Other DBs
NCBI-GeneID: 109522562
NCBI-ProteinID: XP_019736806
UniProt: A0A3Q2ZJ17
LinkDB
Position
Unknown
AA seq 268 aa
MASGLPGVVFLALLCAVLPICVSSDDKHCLAYTDSSSQYHPYERCVQGFCCGTCQSKRCC
SDSFWRFTEDSQEACEARPIFMESSSMLGSVIGGVIFVVVMLIICCVCPCCCLYKVCRKP
QPVIATTTHTTVVTNTPQHYPQQPTTSPGQPQPYQGTPYPAYQPVPMQVGYGGQPMPPQG
YPPQPMPAMPHPGHPYTPGPPPTYQEATGPAYPPNPMPYSQAAFTPGQPSYPLQPPMQPQ
ANATAAQMDYLAQPAYNPDFVSPPPKMG
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcgtcaggcctacccggtgtcgtcttcttggccctactatgtgccgttctgcccatc
tgcgtgtcttcggacgataaacactgtctggcctacaccgactcatcaagccagtatcac
ccatatgagcgatgtgtccaaggattctgctgtggtacttgccaatccaaacggtgctgt
agcgatagtttttggcgctttacggaggatagccaagaagcatgtgaagcccgaccaata
ttcatggaatcctcctccatgttgggttccgtgatcggcggcgtcatctttgtggtcgtg
atgctcatcatctgctgcgtttgtccctgctgttgcctgtacaaggtgtgccgcaagccg
caaccggtaatcgcgaccaccactcacaccacggttgtgaccaacacccctcagcattac
cctcagcaaccaactacgtcgcctgggcaaccacagccctaccaggggaccccttatcca
gcctaccagcctgtaccaatgcaggtgggatatggaggccagcccatgccacctcaggga
tacccaccgcagcccatgcccgctatgccccatccagggcacccttacacaccgggacca
ccgccaacctatcaggaagccactggcccggcctaccctcccaacccgatgccttacagc
caggctgcgttcacccctggccagccgtcctaccctctgcaaccccccatgcagccgcag
gccaatgctacagcagcccagatggactacctggctcagccggcgtacaacccagatttt
gtctctccgccacccaagatgggataa

KEGG   Hippocampus comes (tiger tail seahorse): 109522563
Entry
109522563         CDS       T04969                                 

Definition
(RefSeq) protein shisa-5-like
  KO
K10135  scotin
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109522563
SSDB
Motif
Pfam: Shisa DUF5326 Comm
Other DBs
NCBI-GeneID: 109522563
NCBI-ProteinID: XP_019736807
UniProt: A0A3Q2Y8B4
LinkDB
Position
Unknown
AA seq 209 aa
MVSAVLSIVIFGSCVIFLPSTWADGCSSYWDDSGIRRRDLQCGDIYCCGTCSNKYCCIEK
TRQLSQELCDDRPRFEKHFRSPILLVSILGAVIPIIFCVGLITCFVAPCCFLYKKCRKPR
NSRRHPNVTTTYVVAPHQPASPPHHPPYHPNYQPVPVPPHYGGPAMPTAPVGPQPYMEAA
PPAYPPGGPPPHLDEHSQPPYNPAYGFNP
NT seq 630 nt   +upstreamnt  +downstreamnt
atggtgtcggctgttttgtccattgtaattttcgggtcctgtgtaatatttctaccgtct
acatgggcggacggctgttccagctactgggacgacagtggcattcgtcgtcgtgatctc
cagtgcggtgacatttattgctgtggaacctgcagcaataaatattgctgcattgaaaag
acaaggcagctaagtcaagagctctgcgatgacaggcctcgctttgagaaacacttcagg
tcccccatacttttggtcagcattctcggagcagtcattcccattatcttctgcgtgggg
ctcatcacctgctttgtggctccatgctgctttctgtacaaaaagtgcaggaaaccacgc
aactcacggcggcatccaaatgtgacaactacctatgtcgtcgcaccccatcagccggcc
tccccgcctcaccatccgccgtaccatcccaactaccagcccgtacctgtcccgcctcat
tacggaggccccgccatgcccactgcaccggtgggcccgcagccatacatggaagcagct
cctccagcgtaccctccaggtggtccaccgccacatctagatgaacattcgcaacctccc
tacaaccctgcatatggtttcaacccctaa

DBGET integrated database retrieval system