KEGG   Hippocampus comes (tiger tail seahorse): 109522590
Entry
109522590         CDS       T04969                                 

Gene name
cdk4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
hcq04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109522590 (cdk4)
   04115 p53 signaling pathway
    109522590 (cdk4)
   04218 Cellular senescence
    109522590 (cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109522590 (cdk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109522590 (cdk4)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109522590 (cdk4)
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109522590 (cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 109522590
NCBI-ProteinID: XP_019736843
UniProt: A0A3Q3DMS0
LinkDB
Position
Unknown
AA seq 304 aa
MAHGTSLQYERVAEIGGGAYGTVYKARDTESGRFVALKSVRVQTDHNGLPISTVREVALL
KRLEQFDHPNVVRLMDVCATQRTDQETKVTLVFEHVEQDLKTYLEKAPAPGLAPERIKDL
MKQLLCGLAFLHSNRVMHRDLKPENILVTSQGQVKLADFGLARMYSCHMALTPVVVTLWY
RPPEVLLQSSYATPVDIWSSGCIFAEMFKRKPLFCGESEVDQLGKIFEVIGLPPEEEWPT
GVTISRKHFPPFSARPITDFVPEINEQGAQLLLEMLTFDPCDRISALNALDHPYFRNEEI
LTET
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcccacggcaccagcctccagtatgagcgagtggcagagataggcggcggcgcttac
gggacagtctataaggcccgtgatacggagagtggtcggtttgtggctctcaaaagcgta
cgggtccagacagaccataatggcctgcccatctccacggtcagagaggttgctctgtta
aagcgactggagcagtttgaccaccccaatgtggtgaggcttatggacgtgtgtgccacc
cagaggacagaccaggagactaaagtgactttagtctttgaacacgtggagcaagatctt
aaaacgtacttggagaaagcgccagctccagggttggcccctgaacgcatcaaagacttg
atgaaacaactgctgtgcggtctggcattcttgcactcaaaccgtgtgatgcacagagac
ctgaaaccagagaatattttggtaaccagccagggtcaggtgaagctggctgatttcgga
ctagcgcgcatgtacagttgccatatggccctcactcccgtggtggtgacactgtggtat
cggcctcctgaggttttgctgcagtcgagctacgccacacctgtcgacatctggagctcc
ggctgcatctttgcggaaatgttcaaacgcaaacccttgttctgtggagaatccgaagtg
gaccaactcgggaaaatctttgaagtgattggcctgccaccagaggaggagtggccaact
ggtgttacaatttcaagaaaacacttcccccctttctcggctcgcccaataactgacttt
gttccagagataaatgagcagggagcacaactgctgctggaaatgttaacctttgacccc
tgtgatcgaatatccgccttgaatgcactagatcatccatattttcgcaatgaggagata
ttgactgagacataa

KEGG   Hippocampus comes (tiger tail seahorse): 109527671
Entry
109527671         CDS       T04969                                 

Gene name
cdk6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109527671 (cdk6)
   04115 p53 signaling pathway
    109527671 (cdk6)
   04218 Cellular senescence
    109527671 (cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109527671 (cdk6)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109527671 (cdk6)
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109527671 (cdk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 FTA2
Other DBs
NCBI-GeneID: 109527671
NCBI-ProteinID: XP_019745266
UniProt: A0A3Q2XRC4
LinkDB
Position
Unknown
AA seq 325 aa
MDKETIGTQYEPVAEIGEGAYGKVYKARDLKNGGRFVALKRVRVQTEEEGMPLSTIREVA
VLRQLEAFEHPNVVRLFDVCTVSRTNRETKLTLVFEHVDQDLTTYLEKAPDPGVPPETIK
DMMYQLLQGLDFLHSHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVVVTL
WYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQLGKIFDVVGVPSAEDW
PQEVALPQSAFTPQPAKPIEDLVPDIDEQGRALLLQFLAFNPSRRISAFAALTHPYFQSV
DSLSRSVYAAQPIPGNKPAIEERTA
NT seq 978 nt   +upstreamnt  +downstreamnt
atggacaaagaaacgattggtacgcagtatgagcccgtggccgagattggagaaggcgcc
tatggaaaagtgtacaaagccagagatctgaagaacgggggacgatttgttgccctaaaa
cgagttcgcgtccagacggaggaagaggggatgcctctctcaaccatccgggaggtggcg
gtactgaggcagctggaagcctttgagcatcccaatgttgtcaggctctttgatgtgtgt
acagtgtctcggactaaccgcgaaaccaaactcaccctggtctttgagcatgtggatcaa
gacctgaccacctacctagagaaagcccctgaccccggcgtgccgccagaaaccatcaag
gatatgatgtatcagctgctccaggggctggacttcctgcactcacaccgtgtagttcac
cgtgacctcaaaccgcagaacatcttggtcaccagcggaggacagattaaactagccgac
ttcggtctcgcccgcatctacagcttccagatggcgctcacctctgtggtggtgacactg
tggtaccgagccccggaggtgctgctgcagtctagttacgcgaccccagtggacctgtgg
agcgtcggctgcatctttgctgagatgttcagaaggagacctctgtttcgcgggaactct
gacgtcgatcagctgggaaagatttttgatgttgttggggtaccttcagcagaggactgg
ccccaggaggtggccctaccacagagtgccttcaccccacagcctgctaagccaatagag
gacttggttcctgatatagacgagcaagggcgggccctcttgttgcaattcctcgccttc
aatccctccaggaggatatctgcatttgctgcacttacccacccttatttccaaagtgtg
gacagcctcagtcgaagtgtgtatgcggcacagcctatccccggcaacaagcccgctatt
gaagagaggactgcctga

KEGG   Hippocampus comes (tiger tail seahorse): 109532677
Entry
109532677         CDS       T04969                                 

Definition
(RefSeq) cyclin-dependent kinase 6-like
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109532677
   04115 p53 signaling pathway
    109532677
   04218 Cellular senescence
    109532677
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109532677
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109532677
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109532677
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 109532677
NCBI-ProteinID: XP_019753227
LinkDB
Position
Unknown
AA seq 304 aa
MEGGANLLFYELLTEIGQGSYGKVYKAREVGEGGRLLAVKKFHFCSEASLSSNDNGIPPH
IIREVALLERMKYFQHPNVVKLLDATATLVGRSLDLTLVLEYIDQDLSTYLSVAHPSGLS
RDNIKAVMLQVMRGLDFLHANIVLHRDLKPANILVSSSGLVKITDFGMSRLYSYNVALTP
GVVTLWYRAPEVLLKSSYMSSVDMWSVGCVFAELFLLKPLFNGVNEAQQLQMIFEFIGLP
SEDEWPQDSPMTYSLNLGPKNPHPQLLLSLKPYERDLLLQCLTFMPSRRISAARALDHPF
FSQH
NT seq 915 nt   +upstreamnt  +downstreamnt
atggagggtggcgcaaatttgcttttctatgagctgctgactgagattggccagggctcc
tatggcaaggtgtacaaagccagggaagtgggagagggagggcgcctccttgccgtgaag
aagttccacttctgcagcgaggcatcgttgtcgtccaacgacaacggcatccctccccac
ataatccgtgaggtggcgctgctcgagaggatgaagtactttcaacaccccaacgtcgtc
aagttgttggacgcaactgccacgctggtggggaggtcattggacctcactttagtgttg
gagtacattgaccaggacctgtccacttacctgtctgtagcccatccatctggactcagc
cgggacaacattaaggccgtgatgctgcaggtgatgcgcggcctggacttcctgcacgcc
aatattgtgctgcaccgtgatctcaaaccggccaacatcctggtcagcagcagtggcctg
gttaagatcaccgactttggcatgtctcgtttgtactcctacaacgtggccctcacacca
ggggttgtcacattgtggtatcgagctcctgaagtgctgctcaaatcttcttacatgtca
tctgtggacatgtggagcgtgggatgcgtcttcgctgagctcttcctgcttaagccgctc
tttaacggagtcaatgaggcgcagcagcttcagatgatctttgagttcatcggtttgcca
agtgaggatgagtggccccaggacagccccatgacctactcactcaacttgggccccaag
aatccccacccccagctgctgctttccctgaaaccctacgagagagacctccttctgcaa
tgtttgaccttcatgccgagccgacgcatctcggccgccagagctctcgatcacccattc
ttcagccagcactga

DBGET integrated database retrieval system