KEGG   Hippocampus comes (tiger tail seahorse): 109522656Help
Entry
109522656         CDS       T04969                                 

Gene name
pcsk1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hcq01002]
    109522656 (pcsk1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hcq03110]
    109522656 (pcsk1)
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     109522656 (pcsk1)
Peptidases [BR:hcq01002]
 Serine Peptidases
  Family S8: subtilisin family
   109522656 (pcsk1)
Chaperones and folding catalysts [BR:hcq03110]
 Intramolecular chaperones
  Subtilisin family
   109522656 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert
Motif
Other DBs
NCBI-GeneID: 109522656
NCBI-ProteinID: XP_019736960
LinkDB All DBs
Position
Unknown
AA seq 768 aa AA seqDB search
MELRCRPAVMCCFLAVLSSVIPRSVGSPYVDRQYLNEWAVEIPGGLDAAAEIARELDYQL
VRQIGALKDHFLFRHRKHPRRMKRSATHVTRQLSEDDRVLWAEQQYEKRRSKRASIGQCR
DCPADKLFDDPMWNQQWYLQDTRTSSALPKLDLHVIPVWQKGITGRGVVITVLDDGLEWN
HTDIYSNYDAAASYDFNDNDADPFPRYDATNENKHGTRCAGEIAMQADNNKCGVGVAFNS
KVGGIRMLDGIVTDAIEASSIGFNPEHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQ
KGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLAT
AYSSGDYTDQRITSADLHNECTQTHTGTSASAPLAAGIFALALEQNPDLTWRDLQHIVVW
TSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPATWKHVPEKKQCIVRDDS
FQPRNLKAAGETTIEIPTKACAGQENSIGSLEHVQVEASIEYTRRGDLHITLTSPAGTST
VLLAERERDTSSNGFRNWDFMSVHTWGEDPSGTWTIKITDTSGRMENEGRILSWKLILHG
TSEKPEHIKKPRVYIPYNAVQNDRRGVEHMDDMMVEPTRAPPPMKTKTQALAASDALKKA
QKPATPPYSPTQALLHLLQTAFNRQSPTVQQPPTAGGRQHPGRGSSLLATRIPPQKLYQA
LDMIDKYAGPGHSVYSDYSDGFYSAKPYRHRDDRLLQALFQMIDDDQK
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggaattgagatgtcgtcccgcggtgatgtgttgttttctcgccgtcctctcttccgtg
attccacgctccgtgggctcgccttacgtggacagacagtatctgaacgagtgggccgtc
gagatcccgggtggactggatgccgcggcggagatcgcccgggagctggactaccaattg
gtccgacagattggggccttgaaggaccatttcttgttcagacatcgcaaacatccccgc
aggatgaagcgaagcgccacgcacgtcaccaggcagctgtcggaggatgatcgggtgttg
tgggcagagcagcagtatgagaaacggcgcagcaagcgagcttccattgggcagtgcagg
gactgcccggcagacaagctgtttgatgatcccatgtggaaccagcagtggtacctgcaa
gacacacgcacgtcgtcggccctgcctaagctggacctgcacgtcatcccggtgtggcag
aaaggcatcacgggcagaggggtggtcatcactgttctggatgacggactggaatggaat
cacacagacatctactccaactatgatgcagcagccagctatgacttcaatgacaacgac
gccgacccgttccccagatacgacgccaccaatgaaaacaagcatgggaccagatgtgcc
ggtgagatcgccatgcaagcagacaacaataaatgcggcgttggcgtggccttcaattcc
aaagttggaggcattcgtatgctggatgggattgtgacggatgccatcgaggccagctcg
atcggcttcaatccagagcacgtggacatctacagtgctagttggggacccaatgacgat
ggcaaaaccgtcgagggtccaggtcgtctggctcaaaaagcctttgaatacggcatccag
aagggccgaggcgggaagggctcaatctttgtttgggcatcaggtaacggtggccgccag
ggggataactgtgactgtgatggctacacagacagcatctacactatctcaatcagcagc
gcctcccagcagggcttgtctccgtggtacgctgaaaagtgctcctccacactggctaca
gcgtacagcagtggagactacacagaccagaggattaccagcgctgatctacacaatgag
tgcactcagactcacaccggaacgtctgcgtccgcaccgctagctgcgggaatatttgcc
ttggcactggaacaaaatccagatctgacctggagagacctgcagcacattgtggtctgg
acgtcagagttcgatcccttggccaataatccaggttggaagaggaatggagcgggtctc
atggtcaacagccgctttggttttggacttctcaatgccaaagccttggttgacctcgct
gaccctgctacgtggaagcatgtgccagaaaaaaagcaatgcattgtgagggatgactct
ttccagcccaggaatttgaaagcagcaggggagaccaccatagagattccaactaaagcc
tgcgcggggcaggagaactccattggctcactggagcatgtgcaggtggaggcgagcatt
gaatacaccaggagaggcgatctccatatcacacttacctcaccagctggcaccagcaca
gtgctgctcgctgagcgtgagcgtgacacgtcctccaacggttttagaaattgggatttc
atgtctgtccacacatggggtgaagacccttctggtacttggaccatcaagataactgac
acctcgggccgtatggagaatgagggtcggatcttgagctggaagctgattctccacgga
acatccgagaagccggagcacataaagaagcctcgagtgtatattccctacaatgctgtg
cagaatgaccggcgtggtgtggaacatatggatgacatgatggtggaacccactcgggcc
cctccacctatgaagactaaaacacaagccttagctgcttctgacgcactcaagaaagcc
caaaagccagcaacgcccccatactcccccacacaggccttgctgcatctcctgcagaca
gccttcaacaggcaaagccccaccgtccagcagcccccaacagccggggggaggcagcat
cctggaagggggtcctccctcctggcaacgcgaatccccccacagaagctgtaccaagct
ctggacatgatcgacaagtacgctggcccggggcacagtgtctacagtgactatagcgat
ggcttctacagcgccaagccatacaggcatagagatgaccgcctgctgcaggccctgttt
cagatgatagatgatgaccagaaatga

DBGET integrated database retrieval system