KEGG   Hippocampus comes (tiger tail seahorse): 109522721Help
Entry
109522721         CDS       T04969                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00052  Galactose metabolism
hcq00500  Starch and sucrose metabolism
hcq01100  Metabolic pathways
hcq04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109522721 (gaa)
   00500 Starch and sucrose metabolism
    109522721 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109522721 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109522721 (gaa)
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109522721 (gaa)
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109522721 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil GHL15
Motif
Other DBs
NCBI-GeneID: 109522721
NCBI-ProteinID: XP_019737038
LinkDB All DBs
Position
Unknown
AA seq 826 aa AA seqDB search
MALWVKLTVAAFLAFAFHTFSDLSHMPILYNRQVRNGEPFKSTVRDRLEPRDYYLAVQPS
RCNMSPESRFDCARDRALSRRECEERACCYSPLNDSSKAPWCFYPYSYPGYKMGVLTPTE
RGQAATLTRASPSYLPRDVATLHLEESQESEGCLRLTLKDRWSDRYEVELLTGVPQGKIS
RQDALYTTEYQSNPFGLVVRRASNGRVIMNSTVAPLLFADQYLQLSTTLASSLVSGLGEH
YTSLLLDLNWTSLTLWNRDMAPHAGANLYGSHPFYVVQEGDGLAHGVFLLNSNAIEVILQ
PLPALTWVSTGGILDLYILMGPDAQTVIRQYLQVIGYPMMPPYWSLGFHLCRWGYKSTNI
TRQVARRMHDANFPMVPSCYMNLMMQWNDLDYADKGRIFTNDPLQFGDMTEMVEEFHLRG
LKYVLILDPGISTTSPPGMYRPFDDGLKRDVFIKNATGQLLIGKVWPGATAFPDFTNPET
RRWWEDLIVEFYSKVPVDGLWIDMNEPASFVSGSLEGCPDTELENPPYTPRVVGGRLSAF
TICMSAQQNVSTHYNLHNMYGLTEAFATHRALVKARGKRPFVLSRSSFPSIGRFSGVWTG
DVRSNWEQLGYSIPSVLKFSLFGVPLVGADICGFGGDTTEELCVRWMQLGAFYPFMRNHN
DRQYAPQEPFVFGQKAQAAMRSALNLRYSLLPFLYTLFHHAHTSGDTVARPLFMEFPTDP
HCQIIDRQFLWGSSLLISPVLKEGAMEVAAYLPPGIWYNLHSGQASYSTGEYLLLSAPLD
TINVHLREGHIVPQQEPALTTTVSRTNPFLLTVALSAGDRPRKQSI
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggctctttgggtgaagctaactgtagccgcgtttctggctttcgcgtttcacacattc
tccgatttgagtcacatgcccattctctacaacagacaggttcgaaatggcgagccattt
aaaagcaccgtccgcgatagactcgaaccacgggactattatttggccgtccaaccctcg
cgttgcaatatgtctccggaaagtcgcttcgactgtgcccgggaccgagcgcttagtcgc
cgagagtgtgaagagcgggcttgttgttactctcctctcaacgactcgtcaaaagctccg
tggtgcttctacccttattcctaccctggctacaaaatgggtgtcttgacgcctaccgag
cgaggccaggctgccactttgacccgggcctccccctcttacctacctcgagatgtggcc
actctccacctggaagaaagtcaagagtctgaaggctgcttgcgcctcactttgaaggat
cgatggtcggaccggtatgaagttgaactcctaactggagtccctcagggcaaaattagt
cgtcaagatgccctgtataccactgagtaccagtccaacccttttggattggttgtgagg
cgggcatccaatggaagggtcatcatgaatagcacggtggcccctctgctttttgctgac
cagtatctgcagttgtccaccactctggcctcctcgctggtgtcaggcctcggggagcat
tacacgtctctcctcctggaccttaactggacctccctgactctctggaacagggacatg
gctcctcatgctggtgcaaacctatatggctcgcacccattctatgtggtacaggagggg
gacggactggcccacggggtgttcctactcaacagcaatgccatcgaagtcatcttgcag
cctctgccagctctgacgtgggtgtccacaggtggaatcctagacctgtacattttaatg
ggtcccgacgcgcagaccgttatacgtcaatatctgcaagttatcggttatcccatgatg
cctccctattggtcgttgggcttccacctttgtcgctggggctacaaaagcactaatatc
actcggcaggtggctcggcgaatgcacgatgctaacttccccatggtaccttcatgttac
atgaacctgatgatgcagtggaatgacctggattacgcagacaaaggtaggatcttcacc
aatgaccccttgcaattcggggacatgacagaaatggtggaggaatttcacctaagaggc
ttgaagtacgtcctcatcctggatcctgggatcagtacaacttctcctccaggaatgtac
cgtcccttcgatgatggactcaagcgagatgtattcatcaaaaatgccaccggtcaactc
ttaataggcaaggtttggcctggtgcgacggcgttccctgactttaccaacccggagacc
agacggtggtgggaagacttaattgtggagttttattcgaaagtgccagtagatggatta
tggattgacatgaacgaaccagccagtttcgtttcgggctcactggagggttgtcctgac
acagagcttgagaacccgccgtacacacccagggtggtcggaggccgcttgagtgctttc
actatttgtatgtcggctcagcaaaatgtatccactcactacaacctgcacaacatgtac
ggactgactgaagcttttgccacacacagagctctggtaaaagcgcgcgggaagaggcca
tttgtcctgtctcgctcttccttcccaagcatcggacgcttctccggagtgtggacggga
gatgttagaagcaactgggagcaacttggatattccatcccttcggtgctgaagttcagc
ctcttcggggtgcccctggtcggcgcggacatctgcggcttcgggggtgacaccaccgag
gagttgtgcgtgcgctggatgcagctcggggccttctacccctttatgaggaaccataac
gatcggcaatatgctcctcaggagcctttcgtatttggccagaaggcccaggcggccatg
cggagtgcgctgaatcttcgttactctcttctgccgtttctctacacgctcttccatcac
gcgcacacctctggagacacggtggccaggcctctcttcatggagtttcccactgaccct
cactgtcagatcatagaccgacaattcctctgggggagttctctccttatcagcccagtc
ctcaaggagggtgccatggaagtggccgcttacctgcctcccggcatctggtacaacctg
cacagtggtcaggcgtcgtacagtacaggcgagtacctgcttctgtctgccccgctggac
accattaacgtccatttgagggaggggcacattgtgccccagcaggagccagctttaacg
acaacagtctcgcgcacaaaccccttcctcctgacggtggcgctgtcagcgggagatcgt
ccacgcaaacagtccatttag

DBGET integrated database retrieval system