KEGG   Hippocampus comes (tiger tail seahorse): 109522935
Entry
109522935         CDS       T04969                                 

Definition
(RefSeq) G2 and S phase-expressed protein 1-like
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109522935
SSDB
Motif
Pfam: GTSE1_N ORC6
Other DBs
NCBI-GeneID: 109522935
NCBI-ProteinID: XP_019737321
LinkDB
Position
Unknown
AA seq 484 aa
MERRAGSDVIYLVDEKFDFDVSLSPDSSNCDEDADDVFVDPSRHAAKRAPDHLPSRLEEG
AVGARSSWSPLSGDQLDAVCREAKRLAEQLQRGQWLRGEDEAAAHEDGERFIQDGAAKLA
ALAAPRSLCSPVKRQTFLVQDSPMKDLPPAIRHRLQRGNATAKLGALLPSKPAAPRASSL
IGRGPGAQKSRVASGCKPSPDLDGRAQPSEDILSDSAGAAHDVFDSPLNSSAVGKKRPLA
PPTKVMHRYDRLTVLLAQPDRSYCISCRRLLMTWSPICPFPVVSLQPKASSGPLTPSAGA
SKPLQLHSQRPSGLPTPLKRRASAIPAPTPGSQSRNSRPPRTQAASDSDCPPRTCPSPAP
LDSNRAVPVDVQPFCLEEEPPAEPSQSESPEGKEPSRRGQSEPSEDLVRPESAKREVLLL
DLPAPMPPTHEKLLIDLRNTPDWIRNGTKNCTAMQQLIDLSSPLIKWSPEDKKENSAPLI
NLSF
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggagcgtcgagcgggcagcgatgtgatttatctggtggacgagaagttcgacttcgat
gtttcgctgtcacctgacagctccaactgcgacgaagacgcggatgatgtctttgtggac
ccgtcccgccatgcggccaaacgtgcgcccgatcacttgccctcccgccttgaggaaggg
gctgtcggcgcacggagcagctggagtccgctttcgggggaccagctggacgccgtgtgc
cgggaggccaagcgattggccgaacagctgcagcgcggccaatggctgcggggcgaggat
gaggccgccgcccacgaagacggggagcgcttcatccaggacggcgccgccaaactggcg
gcgctggcggcgccccgcagcctgtgcagccccgtcaaacggcagaccttcctggtgcag
gacagccccatgaaggacctgcccccggctatccggcaccgcttgcagcgaggaaacgcc
accgccaagttgggcgccctcctgcccagcaagccggccgccccgagggcttcctctttg
atcggcaggggccccggcgcccaaaaatcccgagtggcgtcaggttgcaaaccgagtcct
gatctcgacggtcgggcccagcccagcgaggatattctgtcagattccgccggcgcggcg
cacgacgtcttcgactcgcccctcaactccagcgcggtgggaaaaaagcgcccgctggct
ccgcccaccaaagtaatgcaccgttatgatcggttgaccgtgttgttagcgcaacccgac
cgcagctattgcatctcttgtcgtcgcttacttatgacgtggtcacccatctgccccttc
ccggttgttagccttcaaccaaaggcctcaagtggcccgctgacgccctctgcaggagca
agcaaacctctgcagttgcattcccagcgtccctccggtctccccacgccgctcaaacgc
cgggcgtcggccattcccgcgccgacgcccggcagccagagccgaaactccagacccccc
agaacgcaggccgcctcggactcggactgcccccccaggacctgccccagtcccgccccc
ctcgattctaatagggcagtgcctgtcgacgtgcagcccttctgtctggaggaggagcct
cccgccgagcccagccaatcagagagcccggagggcaaagagccatcccgtcgcggccaa
tcggagcccagcgaagacctcgtccggccggagagcgccaaacgggaggttcttttgctg
gaccttcctgctccgatgcccccgacccacgagaaactgctcatcgacctgagaaacact
ccggactggatccgaaacggcaccaagaactgtaccgccatgcagcagctgattgactta
agttcgccgctcatcaagtggagtccggaagacaagaaggagaacagcgcccccctcatc
aacctgtccttctga

DBGET integrated database retrieval system