KEGG   Hippocampus comes (tiger tail seahorse): 109523199
Entry
109523199         CDS       T04969                                 

Gene name
cdk1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04110  Cell cycle
hcq04114  Oocyte meiosis
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
hcq04540  Gap junction
hcq04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109523199 (cdk1)
   04114 Oocyte meiosis
    109523199 (cdk1)
   04115 p53 signaling pathway
    109523199 (cdk1)
   04218 Cellular senescence
    109523199 (cdk1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109523199 (cdk1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109523199 (cdk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109523199 (cdk1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hcq03032]
    109523199 (cdk1)
   03036 Chromosome and associated proteins [BR:hcq03036]
    109523199 (cdk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109523199 (cdk1)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109523199 (cdk1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     109523199 (cdk1)
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109523199 (cdk1)
DNA replication proteins [BR:hcq03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109523199 (cdk1)
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109523199 (cdk1)
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109523199 (cdk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Seadorna_VP7
Other DBs
NCBI-GeneID: 109523199
NCBI-ProteinID: XP_019737752
UniProt: A0A3Q2XQQ2
LinkDB
Position
Unknown
AA seq 303 aa
MDDYLRIEKIGEGTYGVVYRGKHKPTGQIVAMKKIRLESEEEGVPSTAVREVSLLQELKH
PNVVRLLDVLMQESRLYLIFEFLSMDLKKYLDSIPSGQYMEPMLVKSYLYQILEGIYFCH
CRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVRVYTHEVVTLWYRAPEVLLGSPR
YSTPVDVWSAATIFAELATKKPLFQGDSEIDQLFRIFRTLGTPDNVVWPDVESLPDYKST
FPKWKPGNLASTVKNLDKNGLDLLKKMLAYNPPQRISTREALTHCYFDDLDKSTLPSANI
NKI
NT seq 912 nt   +upstreamnt  +downstreamnt
atggacgattatttgagaattgagaaaatcggagaaggtacctatggggtggtgtacaga
ggcaaacacaagcccactggtcaaattgtggcaatgaaaaagatccgtctggagagtgag
gaggaaggggttcccagcactgcggtgagagaggtctccttgcttcaggagctgaagcat
ccaaatgttgtaagactcttagatgtcctgatgcaggagtctcgcctctatcttatcttc
gagttcctgtccatggacctaaagaaatacctggactccatcccttctggccagtacatg
gaaccgatgcttgtcaagagctacctctaccagatcttagagggcatatatttctgtcat
tgtcggcgagtcctccatcgggacctgaagccccagaaccttttgattgacaacaaggga
gttatcaaactggctgactttggactggctcgggcctttggtgttcctgtcagggtctat
acccatgaggttgtaaccctttggtatcgggctcccgaggttctcctgggttccccccga
tattcaactcctgttgacgtttggagcgctgccaccatttttgctgagcttgccacaaag
aagccactgttccaaggagactctgaaatagaccagctctttagaatcttcaggacattg
ggaacaccagataatgttgtttggcctgatgtggaaagcctacctgactacaaaagcact
tttccaaaatggaagcctggcaaccttgcctccacggtgaaaaacctggacaagaatggt
ctggacctattgaaaaaaatgttggcctacaatcctccccaacggatctcaacacgtgag
gccttgactcattgttattttgatgatttggacaagtcaaccctaccctcagccaacatc
aacaaaatctaa

DBGET integrated database retrieval system