KEGG   Hippocampus comes (tiger tail seahorse): 109523465
Entry
109523465         CDS       T04969                                 

Gene name
gorab
Definition
(RefSeq) RAB6-interacting golgin isoform X1
  KO
K19748  RAB6-interacting golgin
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109523465 (gorab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109523465 (gorab)
Membrane trafficking [BR:hcq04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    109523465 (gorab)
SSDB
Motif
Pfam: Transcrip_act SLATT_5
Other DBs
NCBI-GeneID: 109523465
NCBI-ProteinID: XP_019738199
UniProt: A0A3Q2Y0W4
LinkDB
Position
Unknown
AA seq 348 aa
MSGWAGFSEEELRRMQQKDSVIASKSKLRPPSRNRQQLQRKKTLERASQACAGFVSLELP
PEQQLKKMPSKGERDLEHIAPGSPSEKSNTHQTLIEEKTQDNCKEAAKKRTPVVKELEKQ
EVELREKNRLEQLQREQKIIEERNKRKKALLAKTIAEKSKQTQAEAVKLNRIQNELQALD
EMVSSDIGILRGKIEQASWDYTAARKRYDKAETEYVVAKLELQKKTDMKEQLTEHLCAII
QQNELRKALKLEELMQQLQLEATEEELGRQNVEDDNVRSFELQGRVKEQHGVSESQEATV
QSTCTEEESQKKDDGLQLEHQLSDEVQPGQNCKAEVKKCCQDEPLAQT
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgagcggatgggctgggttttcggaagaggaactgcggagaatgcagcaaaaagactct
gtgatagcaagtaagagcaaactacgaccgcccagccggaatcggcaacaactacaaaga
aagaagacattggagagagcctctcaggcatgcgctggtttcgtgtctcttgaacttcca
cccgagcagcagctcaagaagatgccatcgaagggtgagcgtgatcttgagcacattgca
ccaggaagtccgtcagagaaaagcaatacgcatcagactctaatcgaggaaaagacgcaa
gacaactgtaaagaagcagcaaagaagcgaactccggtcgtcaaggagcttgagaaacaa
gaggttgaacttcgagagaagaatcgcctggagcaactgcaacgggaacaaaagattata
gaagaaaggaataagcgcaagaaggctctgcttgcaaaaactatagctgaaaagtctaag
caaactcaagctgaagctgtgaagctgaacagaatccagaatgagctgcaagcccttgat
gagatggtttccagtgacatcggcattctcagaggaaagatcgaacaagctagctgggac
tacacagctgccagaaagcggtatgacaaggcagagacggagtatgtcgtggccaagtta
gaactccagaagaaaacagacatgaaggagcagctgacagaacacctttgtgctatcatc
caacaaaatgagctacgcaaagccctcaagctggaagaactgatgcagcaattgcagctt
gaggccactgaggaggagctcggaaggcagaacgttgaagacgacaatgtgaggagcttt
gaattgcaaggacgtgtgaaagagcagcatggtgtctcagagagtcaggaggcaacagtg
caatcgacatgcacagaggaggaaagtcagaagaaggacgatggcctccagctggagcac
caattgagtgatgaagtccagcctgggcaaaattgtaaagcggaagtaaaaaagtgttgc
caggatgaaccgttggctcagacatga

DBGET integrated database retrieval system